DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5906 and pxmp2

DIOPT Version :9

Sequence 1:NP_648518.1 Gene:CG5906 / 39343 FlyBaseID:FBgn0036217 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_001006885.1 Gene:pxmp2 / 448721 XenbaseID:XB-GENE-951886 Length:193 Species:Xenopus tropicalis


Alignment Length:181 Identity:45/181 - (24%)
Similarity:83/181 - (45%) Gaps:20/181 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RFHQIAFSPKYLLFTNIGISVGLSMVGDTMEQSYERLIGELPDWNRTR----------TIRMGIS 70
            |:.|:..|...|  |....|..||.:|:.:.|:.::       |.:.:          .:|..:.
 Frog    21 RYLQLLHSRPVL--TKALTSAILSALGNILSQTIQK-------WRKEQKHPQNVDLRGPLRFAVY 76

  Fly    71 GLT-VGLVCHYWYQHLDYLFPKRTYKVVVVKILLDQFICSPFYIAVFFLTMAILEDNTWEELEQE 134
            ||. .|.:.||:|..|:.|.|.......:.::|:::.|.:|.::.:|||.|.:||...:.:|.|:
 Frog    77 GLLFTGPLSHYFYLLLEQLVPSSAPLAGLQRLLIERLIIAPAFLLLFFLVMNLLEGKNFTKLNQK 141

  Fly   135 IREKALVLYAAEWTVWPLAQFINFLLIKPQYRVFYDNTISLGYDIYTSQVK 185
            ::..........|.||...||||...:..|:||.:.|.::..:..|.|..:
 Frog   142 LKSSYWQALKLNWKVWTPFQFININYVPVQFRVLFANLVAFFWYAYLSSTR 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5906NP_648518.1 Mpv17_PMP22 122..185 CDD:282035 17/62 (27%)
pxmp2NP_001006885.1 Mpv17_PMP22 128..189 CDD:309301 16/60 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.