DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5906 and pxmp2

DIOPT Version :9

Sequence 1:NP_648518.1 Gene:CG5906 / 39343 FlyBaseID:FBgn0036217 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_001004607.1 Gene:pxmp2 / 447868 ZFINID:ZDB-GENE-040912-184 Length:194 Species:Danio rerio


Alignment Length:186 Identity:46/186 - (24%)
Similarity:90/186 - (48%) Gaps:16/186 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MTNAMDRFHQIAFSPKYLLFTNIGISVGLSMVGDTMEQ--SYERLIGELPDWNRTR-------TI 65
            :..|:.::  ::...||.:.|....|..||.:|:.:.|  .|::.:.|    |..:       .:
Zfish    14 LARALQQY--LSLLKKYPIITKSVTSGILSALGNLLSQVLEYQKNVKE----NSPKKKISILGPV 72

  Fly    66 RMGISGLTV-GLVCHYWYQHLDYLFPKRTYKVVVVKILLDQFICSPFYIAVFFLTMAILEDNTWE 129
            ...|.||.: |.|.||:|..|:.|.|......::.::||::.|.:|.::.:|::.|..||..|..
Zfish    73 HFAIYGLFITGPVSHYFYHLLEVLLPTTVPYCLIKRLLLERLIFAPAFLLLFYVVMNALEGKTLA 137

  Fly   130 ELEQEIREKALVLYAAEWTVWPLAQFINFLLIKPQYRVFYDNTISLGYDIYTSQVK 185
            :::.:::..........|.||...||||...:..|:||.:.|.::|.:..|.:.|:
Zfish   138 DVQNKLKTSYWPAMKMNWKVWTPFQFININYVPVQFRVLFANMVALFWYAYLASVR 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5906NP_648518.1 Mpv17_PMP22 122..185 CDD:282035 16/62 (26%)
pxmp2NP_001004607.1 Mpv17_PMP22 131..194 CDD:282035 17/63 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.