DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5906 and CG11077

DIOPT Version :9

Sequence 1:NP_648518.1 Gene:CG5906 / 39343 FlyBaseID:FBgn0036217 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_651944.1 Gene:CG11077 / 43831 FlyBaseID:FBgn0039930 Length:168 Species:Drosophila melanogaster


Alignment Length:159 Identity:52/159 - (32%)
Similarity:82/159 - (51%) Gaps:11/159 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 GISVGLSM-VGDTMEQ-SYERLIGELPDWNRTRTIRMGISGLT-VGLVCHYWYQHLDYLFPKRTY 94
            ||:|...| :|||:.| .:::  ..|.:|:..||:|.||.||. ||.....||..|:...|| ||
  Fly    11 GINVAAVMCLGDTISQFFFDK--KSLDEWDAGRTLRFGIVGLVFVGPTLRRWYHFLESRVPK-TY 72

  Fly    95 KVV---VVKILLDQ-FICSPFYIAVFFLTMAILEDNTWEELEQEIREKALVLYAAEWTVWPLAQF 155
            ..:   |.|:|:|| ....||.:|:.|| :.:......:.:.|.|.:..|.:....:.:||.||.
  Fly    73 SPMRRGVTKMLVDQTLFAPPFTMAMSFL-VPLSNGEPIDRIRQRILDSYLSILVRNYMLWPAAQM 136

  Fly   156 INFLLIKPQYRVFYDNTISLGYDIYTSQV 184
            :||..:...|:|.|...|:|.::.|.|.:
  Fly   137 LNFRFVPLGYQVLYAQFIALVWNCYLSMI 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5906NP_648518.1 Mpv17_PMP22 122..185 CDD:282035 16/63 (25%)
CG11077NP_651944.1 Mpv17_PMP22 106..167 CDD:282035 16/60 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463149
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11266
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.