DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5906 and mpv17l2

DIOPT Version :9

Sequence 1:NP_648518.1 Gene:CG5906 / 39343 FlyBaseID:FBgn0036217 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_001002567.1 Gene:mpv17l2 / 436840 ZFINID:ZDB-GENE-040718-306 Length:199 Species:Danio rerio


Alignment Length:172 Identity:68/172 - (39%)
Similarity:97/172 - (56%) Gaps:4/172 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 FSPKYLLFTNIGISVGLSMVGDTMEQSYE--RLIGELPDWNRTRTIRMGISGLTVGLVCHYWYQH 84
            |..::|:.||.....|:...||.::|:.|  |..|...||:||..  |...|.::|...|||||.
Zfish    21 FRGRFLIVTNTVSCGGMLAAGDLIQQTREIRRTPGRTRDWSRTGC--MFAVGCSMGPFMHYWYQW 83

  Fly    85 LDYLFPKRTYKVVVVKILLDQFICSPFYIAVFFLTMAILEDNTWEELEQEIREKALVLYAAEWTV 149
            ||..|.......|..|:|:||.:.||...|.:||.|.::|.:|:.|.:||.|:|....|.|:|.|
Zfish    84 LDKYFIGNGINNVCKKVLVDQLVASPTLGAWYFLGMGMMEGHTFIEAQQEFRDKFWEFYKADWCV 148

  Fly   150 WPLAQFINFLLIKPQYRVFYDNTISLGYDIYTSQVKYRKKPE 191
            ||.||.|||..:.|::||.|.|.::||:|.|.|.:|:|...|
Zfish   149 WPAAQMINFYFLPPKFRVLYVNIVTLGWDTYLSYLKHRDTVE 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5906NP_648518.1 Mpv17_PMP22 122..185 CDD:282035 28/62 (45%)
mpv17l2NP_001002567.1 Mpv17_PMP22 121..185 CDD:282035 28/63 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580472
Domainoid 1 1.000 71 1.000 Domainoid score I9406
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H13093
Inparanoid 1 1.050 132 1.000 Inparanoid score I4597
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 1 1.000 - - FOG0003674
OrthoInspector 1 1.000 - - otm25042
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11266
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2546
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.860

Return to query results.
Submit another query.