DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5906 and plh

DIOPT Version :9

Sequence 1:NP_648518.1 Gene:CG5906 / 39343 FlyBaseID:FBgn0036217 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_649511.2 Gene:plh / 40615 FlyBaseID:FBgn0037292 Length:193 Species:Drosophila melanogaster


Alignment Length:178 Identity:42/178 - (23%)
Similarity:82/178 - (46%) Gaps:6/178 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 IAFSPKYLLFTNIGISVG-LSMVGDTMEQS-YERLIGELPDWNRTRTIRMGISG-LTVGLVCHYW 81
            :..:.||.:...: ||.| |...|..:||: .|:......||  .:.:|..:.| ..:|...:.|
  Fly     6 VNITSKYKVLRGM-ISYGTLWPCGSLIEQTMIEKKTFRTYDW--MKCLRFSLFGFFFMGPTIYVW 67

  Fly    82 YQHLDYLFPKRTYKVVVVKILLDQFICSPFYIAVFFLTMAILEDNTWEELEQEIREKALVLYAAE 146
            .:....::|:...|..:.|.:.:|....|..|:.|...|.::|.|::.|.::|:.:|.|..|...
  Fly    68 IRLASVMWPRTDIKSSLCKAITEQTAYDPMAISSFLFFMTLMEGNSYAEAKREVSDKFLDAYKVG 132

  Fly   147 WTVWPLAQFINFLLIKPQYRVFYDNTISLGYDIYTSQVKYRKKPEPKD 194
            ...||..|.:||..:..:.:|.:.:..|:.:..:.:.||:.:...|.|
  Fly   133 VIYWPCVQTVNFAFVPARNQVVFTSFFSMCWTTFLAYVKFLQLHPPVD 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5906NP_648518.1 Mpv17_PMP22 122..185 CDD:282035 14/62 (23%)
plhNP_649511.2 Mpv17_PMP22 108..171 CDD:282035 14/62 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463154
Domainoid 1 1.000 54 1.000 Domainoid score I4140
eggNOG 1 0.900 - - E1_KOG1944
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11266
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.