DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5906 and mpv17

DIOPT Version :9

Sequence 1:NP_648518.1 Gene:CG5906 / 39343 FlyBaseID:FBgn0036217 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_957459.2 Gene:mpv17 / 394140 ZFINID:ZDB-GENE-040426-1168 Length:177 Species:Danio rerio


Alignment Length:178 Identity:48/178 - (26%)
Similarity:72/178 - (40%) Gaps:11/178 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LWRRMTNAMDRFHQIAFSPKYLLFTNIGISVGLSMVGDTMEQSYERLIGELPDWNRTRTIR-MGI 69
            |||.....|      |..|..:.....|..||   |||.:.|......| |.:.|..||.: |.|
Zfish     4 LWRSYQALM------AKHPWKVQIITAGSLVG---VGDVISQQLIERRG-LANHNARRTAKMMSI 58

  Fly    70 SGLTVGLVCHYWYQHLDYLFPKRTYKVVVVKILLDQFICSPFYIAVFFLTMAILEDNTWEELEQE 134
            ....||.|...||:.||.|....|....:.|:|:||...:|.::..|......|...|.||...:
Zfish    59 GFFFVGPVVGGWYKVLDKLVTGGTKSAALKKMLVDQVGFAPCFLGAFLGITGTLNGLTVEENVAK 123

  Fly   135 IREKALVLYAAEWTVWPLAQFINFLLIKPQYRVFYDNTISLGYDIYTS 182
            ::........:.:.:||..|..||..|...:|:.....:::.::.|.|
Zfish   124 LQRDYTDALISNYYLWPPVQIANFYFIPLHHRLAVVQIVAVVWNSYLS 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5906NP_648518.1 Mpv17_PMP22 122..185 CDD:282035 13/61 (21%)
mpv17NP_957459.2 Mpv17_PMP22 112..175 CDD:282035 13/60 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.