DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5906 and CG32262

DIOPT Version :9

Sequence 1:NP_648518.1 Gene:CG5906 / 39343 FlyBaseID:FBgn0036217 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_647831.1 Gene:CG32262 / 38445 FlyBaseID:FBgn0052262 Length:273 Species:Drosophila melanogaster


Alignment Length:176 Identity:63/176 - (35%)
Similarity:97/176 - (55%) Gaps:5/176 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RFHQIAFS---PKYLLFTNIGISVGLSMVGDTMEQSYE--RLIGELPDWNRTRTIRMGISGLTVG 75
            |:.:||:|   .||||.||:..|..|.:|||.:.|.||  |.:.....::..|..||.::|...|
  Fly    63 RWTKIAWSNMFGKYLLVTNVVGSGLLMVVGDVIAQEYEYRRGLRHQDRFDTDRMYRMFVAGALQG 127

  Fly    76 LVCHYWYQHLDYLFPKRTYKVVVVKILLDQFICSPFYIAVFFLTMAILEDNTWEELEQEIREKAL 140
            .:.||.|..:|.:.|.||.|.:..|||:||.:.||..|.:||.::..||..|.:...||:..|..
  Fly   128 PLHHYVYNWMDRVMPARTLKNIFKKILIDQLVMSPACIVIFFYSLCYLERQTLDATNQELISKFP 192

  Fly   141 VLYAAEWTVWPLAQFINFLLIKPQYRVFYDNTISLGYDIYTSQVKY 186
            .:|..:|..||.||::||..:..:|||.:.|..:..|::..|.:|:
  Fly   193 YVYMLDWMTWPAAQYLNFRYLDTKYRVTFVNVCTAVYNVLMSYMKH 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5906NP_648518.1 Mpv17_PMP22 122..185 CDD:282035 20/62 (32%)
CG32262NP_647831.1 Mpv17_PMP22 175..238 CDD:282035 20/62 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463133
Domainoid 1 1.000 54 1.000 Domainoid score I4140
eggNOG 1 0.900 - - E1_KOG1944
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2532
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D104780at33392
OrthoFinder 1 1.000 - - FOG0003674
OrthoInspector 1 1.000 - - otm3031
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11266
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2546
109.900

Return to query results.
Submit another query.