DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5906 and CG7970

DIOPT Version :9

Sequence 1:NP_648518.1 Gene:CG5906 / 39343 FlyBaseID:FBgn0036217 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_001303378.1 Gene:CG7970 / 38205 FlyBaseID:FBgn0035252 Length:255 Species:Drosophila melanogaster


Alignment Length:154 Identity:33/154 - (21%)
Similarity:65/154 - (42%) Gaps:2/154 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SVGLSMVGDTMEQSYERLIGELPDWNRTRTIRMGISGLTV-GLVCHYWYQHLDYLFPKRTYKVVV 98
            |:...::..:...:.:||.| ....|:......|:.||.. |.|.||:|..::.||.:.......
  Fly    91 SITACVLATSANVTSQRLAG-AKTLNQQSVFAYGLFGLIFGGSVPHYFYTTVERLFSQDVRFRRF 154

  Fly    99 VKILLDQFICSPFYIAVFFLTMAILEDNTWEELEQEIREKALVLYAAEWTVWPLAQFINFLLIKP 163
            ...|.::.:.:|.|.|:....:|:.|..:.....:.:.:....|..|.|....:..::||..:.|
  Fly   155 FLFLSERLVYAPIYQALSLFFLALFEGKSPSTALKNVEKLYWPLLKANWQYLSVFVYLNFAYVPP 219

  Fly   164 QYRVFYDNTISLGYDIYTSQVKYR 187
            .:|......||..:.:|.:|.:.|
  Fly   220 MFRSISMAIISFIWVVYIAQKRRR 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5906NP_648518.1 Mpv17_PMP22 122..185 CDD:282035 12/62 (19%)
CG7970NP_001303378.1 Mpv17_PMP22 178..238 CDD:282035 11/59 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463147
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11266
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.