DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5906 and Mpv17

DIOPT Version :9

Sequence 1:NP_648518.1 Gene:CG5906 / 39343 FlyBaseID:FBgn0036217 Length:196 Species:Drosophila melanogaster
Sequence 2:XP_038968365.1 Gene:Mpv17 / 360463 RGDID:1310512 Length:207 Species:Rattus norvegicus


Alignment Length:159 Identity:44/159 - (27%)
Similarity:74/159 - (46%) Gaps:12/159 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 TNIGISVGLSMVGDTMEQSYERLIGELPDWNRTRTIRMGISGL-TVGLVCHYWYQHLDYLFPKRT 93
            |::..:..|..:||.:.|......| |......||:.|...|. .||.|...||:.||:|.|..|
  Rat    49 THVPCTGSLMGLGDIISQQLVERRG-LQQHQTGRTLTMASLGCGFVGPVVGGWYRVLDHLIPGTT 112

  Fly    94 YKVVVVKILLDQFICSPFYIAVFFLTMAIL-----EDNTWEELEQEIREKALVLYAAEWTVWPLA 153
            ....:.|:||||...:|.::..|...:.:|     :|| |.:|:::..:..:..|    .:||..
  Rat   113 KVNALKKMLLDQGGFAPCFLGCFLPLVGVLNGMSAQDN-WAKLKRDYPDALITNY----YLWPAV 172

  Fly   154 QFINFLLIKPQYRVFYDNTISLGYDIYTS 182
            |..||.|:...||:.....:::.::.|.|
  Rat   173 QLANFYLVPLHYRLAVVQCVAVVWNSYLS 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5906NP_648518.1 Mpv17_PMP22 122..185 CDD:282035 16/66 (24%)
Mpv17XP_038968365.1 Mpv17_PMP22 140..201 CDD:397992 15/65 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.