DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5906 and T18D3.9

DIOPT Version :9

Sequence 1:NP_648518.1 Gene:CG5906 / 39343 FlyBaseID:FBgn0036217 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_001024916.1 Gene:T18D3.9 / 3564939 WormBaseID:WBGene00011826 Length:181 Species:Caenorhabditis elegans


Alignment Length:173 Identity:41/173 - (23%)
Similarity:79/173 - (45%) Gaps:10/173 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 QIAFSPKYLLFTNIGISVGLSMVGDTMEQSYERLIGELPDWNRTRTIRMG-ISGLTVGLVCHYWY 82
            ::|.:|   |.|.:.|:..:|..||.:.|    .:....:|:|.||.|.. :|...:......|:
 Worm    10 RLATNP---LSTQMCIAGTISGSGDCLAQ----YLSHNQEWDRWRTARFSFLSSCFMAPSLFIWF 67

  Fly    83 QHLDYLFPKRTYKVVVVKILLDQFICSPFYIAVFFLTMAILEDNTWEELEQEIREKALVLYAAEW 147
            :.|:.:.......::|.|:.:||...||.:.|.....:.:|:..:.|:....::|....:||...
 Worm    68 RLLEKVKGNNKSLLLVKKLCIDQLCFSPCFNAAILFNLRLLQHQSAEKSWDLLKEDWFNIYATSL 132

  Fly   148 TVWPLAQFINFLLIKPQYRVFYDNTISLGYDIYTSQVKYRKKP 190
            .|||..|.:|...:...|||..:..::..::.|.|.:  .:||
 Worm   133 KVWPFVQVVNLCFVPLNYRVILNQVVAFFWNCYLSYI--TQKP 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5906NP_648518.1 Mpv17_PMP22 122..185 CDD:282035 15/62 (24%)
T18D3.9NP_001024916.1 Mpv17_PMP22 107..171 CDD:282035 15/65 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.