DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5906 and CG14778

DIOPT Version :9

Sequence 1:NP_648518.1 Gene:CG5906 / 39343 FlyBaseID:FBgn0036217 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_569918.1 Gene:CG14778 / 31100 FlyBaseID:FBgn0029580 Length:186 Species:Drosophila melanogaster


Alignment Length:194 Identity:47/194 - (24%)
Similarity:86/194 - (44%) Gaps:16/194 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALRVLWRRMTNAMDRFHQIAFSPKYLLFTNIGISVGLSMV---GDTMEQSYERLIGELPDWNRT 62
            ||..:||:...         .|..:|.:...:   :..|::   |..::|:.|.......||.|.
  Fly     1 MAGPLLWQNFK---------VFVTRYPIMRGM---ISYSLIWPTGSLIQQTVEGRRWGTYDWWRV 53

  Fly    63 RTIRMGISGLTVGLVCHYWYQHLDYLFPKRTYKVVVVKILLDQFICSPFYIAVFFLTMAILEDNT 127
            ....| ..||.|....:.|.:....::|:.:.:..|:|..::....:|..:..|:..|::||..|
  Fly    54 LRFSM-YGGLFVAPTLYGWVKISSAMWPQTSLRTGVIKAAVETISYTPGAMTCFYFIMSLLESKT 117

  Fly   128 WEELEQEIREKALVLYAAEWTVWPLAQFINFLLIKPQYRVFYDNTISLGYDIYTSQVKYRKKPE 191
            .|:...|:.:|.|..|....:||||...|||.||..:.||.:.:..||.:..:.:.:|:.:..|
  Fly   118 VEQAVAEVGKKFLPTYKVALSVWPLVATINFTLIPERNRVPFISACSLCWTCFLAYMKHLEHHE 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5906NP_648518.1 Mpv17_PMP22 122..185 CDD:282035 21/62 (34%)
CG14778NP_569918.1 Mpv17_PMP22 112..176 CDD:282035 21/63 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463153
Domainoid 1 1.000 54 1.000 Domainoid score I4140
eggNOG 1 0.900 - - E1_KOG1944
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11266
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.