DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5906 and CG14777

DIOPT Version :9

Sequence 1:NP_648518.1 Gene:CG5906 / 39343 FlyBaseID:FBgn0036217 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_001162634.1 Gene:CG14777 / 31099 FlyBaseID:FBgn0026872 Length:196 Species:Drosophila melanogaster


Alignment Length:157 Identity:46/157 - (29%)
Similarity:78/157 - (49%) Gaps:7/157 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GDTMEQSYE-RLIGELPDWNRTRTIRMGISG-LTVGLVCHYWYQHLDYLFPKRTYKVVVVKILLD 104
            |..::|:.| |.:.|. ||  .|.:|..:.| |.|....:.|.:....::|:...:..:||.:.:
  Fly    39 GSLIQQAMEGRKLREY-DW--ARALRFSLFGALYVAPTLYGWVRLTSAMWPQTNLRTGIVKAITE 100

  Fly   105 QFICSPFYIAVFFLTMAILEDNTWEELEQEIREKALVLYAAEWTVWPLAQFINFLLIKPQYRVFY 169
            |....||....||:.|::||..|:.:..:|.:|||...|.....:||:.|.|||.|:....||.:
  Fly   101 QLSYGPFACVSFFMGMSLLELKTFSQAVEETKEKAAPTYKVGVCIWPILQTINFSLVPEHNRVVF 165

  Fly   170 DNTISLGYDIYTSQVKYRKKPEPKDNS 196
            .:..||.:.|:.:.:|...  |.:.||
  Fly   166 VSICSLMWTIFLAYMKTHH--EEQSNS 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5906NP_648518.1 Mpv17_PMP22 122..185 CDD:282035 20/62 (32%)
CG14777NP_001162634.1 Mpv17_PMP22 118..181 CDD:282035 20/62 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463155
Domainoid 1 1.000 54 1.000 Domainoid score I4140
eggNOG 1 0.900 - - E1_KOG1944
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11266
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.