DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5906 and Pxmp2

DIOPT Version :9

Sequence 1:NP_648518.1 Gene:CG5906 / 39343 FlyBaseID:FBgn0036217 Length:196 Species:Drosophila melanogaster
Sequence 2:XP_038945225.1 Gene:Pxmp2 / 29533 RGDID:61812 Length:227 Species:Rattus norvegicus


Alignment Length:209 Identity:47/209 - (22%)
Similarity:83/209 - (39%) Gaps:56/209 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KYLLFTNI------GISVG-LSMVGDTMEQSYERLIGELPDWNRTRTIRMGISGL---------T 73
            :||||...      .:|.| ||.:|:.:.|..|:.       .:..:..:.:|||         .
  Rat    24 QYLLFLKFYPVVTKAVSSGILSALGNLLAQMIEKK-------QKKDSRSLEVSGLLRYLVYGLFV 81

  Fly    74 VGLVCHYWYQHLDYLFPKRTYKVVVVKILLDQFICSPFYIAVFFLTMAILE--DNTW-------- 128
            .|.:.||.|..::|..|.......|.::|||:...:|.::.:||..|.:||  ...|        
  Rat    82 TGPLSHYLYLFMEYWVPPEVPWARVKRLLLDRLFFAPTFLLLFFFVMNLLEVLSQAWWLVPVIAI 146

  Fly   129 ------EELEQ-----EIREKALVLYAAE------------WTVWPLAQFINFLLIKPQYRVFYD 170
                  |:..:     |.:.|.:.::.|:            |.:|...||||...:..|:||.:.
  Rat   147 LRRLRKEDYHKFKVILEYKGKNISVFVAKMRSGFWPALQMNWRMWTPLQFININYVPLQFRVLFA 211

  Fly   171 NTISLGYDIYTSQV 184
            |..:|.:..|.:.:
  Rat   212 NMAALFWYAYLASL 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5906NP_648518.1 Mpv17_PMP22 122..185 CDD:282035 19/96 (20%)
Pxmp2XP_038945225.1 Mpv17_PMP22 165..223 CDD:397992 14/57 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.