DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5906 and Mpv17l2

DIOPT Version :9

Sequence 1:NP_648518.1 Gene:CG5906 / 39343 FlyBaseID:FBgn0036217 Length:196 Species:Drosophila melanogaster
Sequence 2:XP_008769309.1 Gene:Mpv17l2 / 290645 RGDID:1308064 Length:206 Species:Rattus norvegicus


Alignment Length:186 Identity:70/186 - (37%)
Similarity:97/186 - (52%) Gaps:12/186 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WRRMTNAMDRFHQIAFSPKYLLFTN-IGISVGLSMVGDTMEQSYERLIGELPD--WNRTRTIRMG 68
            |.|...|..|   ..|..:.||.|| :|..| |...||...|::|  :...|:  ::..|:..|.
  Rat     8 WARKALAAGR---PLFQGRALLVTNTLGCGV-LMATGDGARQAWE--VRARPEQRFSARRSASMF 66

  Fly    69 ISGLTVGLVCHYWYQHLDYLFPK---RTYKVVVVKILLDQFICSPFYIAVFFLTMAILEDNTWEE 130
            ..|.::|...|:||..||.|.|.   |:...|:.|:|:||.:.||.....:||.:..||..|.||
  Rat    67 AVGCSMGPFLHFWYLWLDRLLPASGLRSLPSVMKKVLVDQTVASPILGVWYFLGLGSLEGQTLEE 131

  Fly   131 LEQEIREKALVLYAAEWTVWPLAQFINFLLIKPQYRVFYDNTISLGYDIYTSQVKY 186
            ..||:|.|....|.|:|.|||.||.:|||.|...:||.|.|.::||:|.|.|.:||
  Rat   132 SCQELRAKFWDFYKADWCVWPAAQLVNFLFIPSHFRVTYINGLTLGWDTYLSYLKY 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5906NP_648518.1 Mpv17_PMP22 122..185 CDD:282035 30/62 (48%)
Mpv17l2XP_008769309.1 Mpv17_PMP22 124..186 CDD:282035 30/61 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340664
Domainoid 1 1.000 69 1.000 Domainoid score I9413
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H13093
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 1 1.000 - - FOG0003674
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11266
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2546
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.810

Return to query results.
Submit another query.