DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5906 and CG12355

DIOPT Version :10

Sequence 1:NP_648518.1 Gene:CG5906 / 39343 FlyBaseID:FBgn0036217 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_001097610.1 Gene:CG12355 / 2768954 FlyBaseID:FBgn0040805 Length:204 Species:Drosophila melanogaster


Alignment Length:173 Identity:49/173 - (28%)
Similarity:79/173 - (45%) Gaps:25/173 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RRMTNAMDRFHQIAFSPKYLLFTNIGISVGLSMVGDTMEQSYERLIGELPDWNRTRTIRMGISGL 72
            |.::...:.||      :|...||..| .|...||....|.:..     ..|..|.:....|...
  Fly     3 RLISGVRNLFH------RYPFVTNSAI-YGSLYVGAEYSQQFAS-----KRWLATASKPEDIDYA 55

  Fly    73 TVGL-----------VCHYWYQHLDYLFPKRTYKVVVVKILLDQFICSPFYIAVFFLTMAILEDN 126
            |:|.           ..:.||:.||..||..|..::|.|::||||:.:|:.:.||:..|:|:|.:
  Fly    56 TIGRYAVMGTAVYAPTLYLWYKWLDRAFPGTTKVIIVKKLVLDQFVLTPYLLTVFYAGMSIMEGS 120

  Fly   127 TWEELEQEIREKALVLYAAEWTVWPLAQFINFLLIKPQYRVFY 169
            .  ::..|:|||.:..:......|..||.:||.|:.|::||.|
  Fly   121 A--DIFLELREKFVPTFMRSCIFWLPAQALNFSLVAPRFRVIY 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5906NP_648518.1 Mpv17_PMP22 121..182 CDD:461182 16/49 (33%)
CG12355NP_001097610.1 Mpv17_PMP22 115..174 CDD:461182 16/49 (33%)

Return to query results.
Submit another query.