DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5906 and SPAC3G6.05

DIOPT Version :9

Sequence 1:NP_648518.1 Gene:CG5906 / 39343 FlyBaseID:FBgn0036217 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_594971.1 Gene:SPAC3G6.05 / 2543194 PomBaseID:SPAC3G6.05 Length:206 Species:Schizosaccharomyces pombe


Alignment Length:162 Identity:43/162 - (26%)
Similarity:76/162 - (46%) Gaps:15/162 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 GISVGLSMVGDTMEQSYER-LIG----------ELPDWNRTRTIRMGISGLTVGLVCHYWYQHLD 86
            |||..::. |.|:.|:.:. :||          |:|  :..|.::....|..:......|.:.|.
pombe    30 GISDAVAQ-GLTIYQTNKNAMIGLDGVRLNTHPEIP--SIKRVLQFVTFGFAISPFQFRWLRLLS 91

  Fly    87 YLFPKRTYKVVVVK-ILLDQFICSPFYIAVFFLTMAILEDNTWEELEQEIREKALVLYAAEWTVW 150
            ..||.....:.||| :||||.:.:||..|.||..|.:.|...:.....:::........|.:.||
pombe    92 AKFPIEKGAINVVKRVLLDQAVFAPFGTAFFFSWMTLAEGKGFRGAYDKLQAVFWPTLKANYMVW 156

  Fly   151 PLAQFINFLLIKPQYRVFYDNTISLGYDIYTS 182
            |..|.:||.|:..||::.:..|:::.::|:.|
pombe   157 PFFQTVNFWLMPLQYQMPFACTVAIFWNIFLS 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5906NP_648518.1 Mpv17_PMP22 122..185 CDD:282035 14/61 (23%)
SPAC3G6.05NP_594971.1 Mpv17_PMP22 128..192 CDD:282035 14/61 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.