DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5906 and ZK470.1

DIOPT Version :9

Sequence 1:NP_648518.1 Gene:CG5906 / 39343 FlyBaseID:FBgn0036217 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_508708.3 Gene:ZK470.1 / 191323 WormBaseID:WBGene00022744 Length:180 Species:Caenorhabditis elegans


Alignment Length:169 Identity:53/169 - (31%)
Similarity:81/169 - (47%) Gaps:11/169 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 FSPKYLLFTNIGISVGLSMVGDTMEQSYERLIGEL--PDWNRTRTIRMGISGLTVGLVCHYWYQH 84
            |..::||.||:|.|.......|.::|   .:.|::  ..|:..||.||...||.:....|.:|:.
 Worm     8 FLARHLLLTNVGTSCAQIGTADIIQQ---HINGDVDRDGWDWRRTCRMAAIGLVMAPSLHCFYRV 69

  Fly    85 LD--YLFPKRTYKVVVVKILLD-QFICSPFYIAVFFLTMAILEDNTWEELEQEIREKALVLYAAE 146
            ||  .....|..| |:.|:..| .||  |::..:|....:|.|..:......|.|.|...::..:
 Worm    70 LDTRKFIGSRNCK-VLKKLAWDTAFI--PYFSCIFMTVGSIYEGKSLSAAFAEYRRKMWHIWKVD 131

  Fly   147 WTVWPLAQFINFLLIKPQYRVFYDNTISLGYDIYTSQVK 185
            :|:||.||.|||..:.|..||.|.|.:||.|:...|.:|
 Worm   132 FTLWPPAQLINFYFMPPALRVVYVNLVSLLYNCIMSYIK 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5906NP_648518.1 Mpv17_PMP22 122..185 CDD:282035 22/62 (35%)
ZK470.1NP_508708.3 Nuc-transf <27..>54 CDD:294849 8/29 (28%)
Mpv17_PMP22 109..171 CDD:282035 22/62 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159187
Domainoid 1 1.000 54 1.000 Domainoid score I7511
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H13093
Inparanoid 1 1.050 102 1.000 Inparanoid score I3550
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG29367
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 1 1.000 - - FOG0003674
OrthoInspector 1 1.000 - - otm14683
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11266
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2546
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.