DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5906 and ZK470.14

DIOPT Version :10

Sequence 1:NP_648518.1 Gene:CG5906 / 39343 FlyBaseID:FBgn0036217 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_001257006.1 Gene:ZK470.14 / 13220194 WormBaseID:WBGene00219362 Length:368 Species:Caenorhabditis elegans


Alignment Length:123 Identity:24/123 - (19%)
Similarity:57/123 - (46%) Gaps:15/123 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 IRMGISGLTVGLVCHYWYQHLDYLFPKRTYKVVVVKILLDQFICSPFYIAVFFLTMAILED---N 126
            ||:|::  .:|::|:......:.:..:..:.::.:::|: .|:.....|....:|:..:.|   |
 Worm    77 IRLGLT--ILGIICNISVLVANLVNGRNKHGILKIRLLV-LFLILVMTITCILMTVIFVFDCLTN 138

  Fly   127 TWEELEQEIREKALVLYAAEWT-VW-PLAQFINFLLIKPQYRVFYDNTISLGYDIYTS 182
            .:.:|:..:.|..   |..|.: :| .||.|    |::|.:.:.....:.:..|.|.|
 Worm   139 IYVDLQTLLSEPE---YHDEMSFLWRNLADF----LLQPMFDLQSIMMMYIALDRYAS 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5906NP_648518.1 Mpv17_PMP22 121..182 CDD:461182 14/65 (22%)
ZK470.14NP_001257006.1 None

Return to query results.
Submit another query.