DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycA and CCNE2

DIOPT Version :9

Sequence 1:NP_524030.2 Gene:CycA / 39340 FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_477097.1 Gene:CCNE2 / 9134 HGNCID:1590 Length:404 Species:Homo sapiens


Alignment Length:256 Identity:78/256 - (30%)
Similarity:127/256 - (49%) Gaps:40/256 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 DISHNMRSILIDWLVEVSEEYKLDTETLYLSVFYLDRF-LSQMAVVRSKLQLVGTAAMYIAAKYE 293
            |:...|||||:|||:||.|.|.|..||.||:..:.||| |:|..:.::.|||:|..:::||:|.|
Human   136 DLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDINKNMLQLIGITSLFIASKLE 200

  Fly   294 EIYPPEVGEFVFLTDDSYTKAQVLRMEQVILKILSFDLCTPTAYVFINTYA---VLCDMPEKL-- 353
            |||.|::.||.::||.:.::..:||||.:|||.|.::||..|...::|.:.   .|.|.|:.|  
Human   201 EIYAPKLQEFAYVTDGACSEEDILRMELIILKALKWELC
PVTIISWLNLFLQVDALKDAPKVLLP 265

  Fly   354 -----------KYMTLYISELSLMEGETYLQYLPSLMSSASVALARHILGMEMWTPRLE------ 401
                       :.:.|.|..:..:|.:..:....:|....|:.:.:...|:| |....|      
Human   266 QYSQETFIQIAQLLDLCILAIDSLEFQYRILTAAALCHFTSIEVVKKASGLE-WDSISECVDWMV 329

  Fly   402 -------EITTYKLEDLKTVVL---HLCHTHKTAKELNTQAMREKYNR-DTYKKVAMMESV 451
                   ..:..||:..|.:.:   |...||     .|..||.|:.|. :|::|...:..|
Human   330 PFVNVVKSTSPVKLKTFKKIPMEDRHNIQTH-----TNYLAMLEEVNYINTFRKGGQLSPV 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 47/102 (46%)
Cyclin_C 334..450 CDD:281044 28/148 (19%)
CCNE2NP_477097.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44
Cyclin_N 112..239 CDD:278560 47/102 (46%)
Cyclin_C 241..361 CDD:281044 21/125 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146216
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.