DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycA and CCNB2

DIOPT Version :9

Sequence 1:NP_524030.2 Gene:CycA / 39340 FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_004692.1 Gene:CCNB2 / 9133 HGNCID:1580 Length:398 Species:Homo sapiens


Alignment Length:372 Identity:106/372 - (28%)
Similarity:184/372 - (49%) Gaps:33/372 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 DNNDTQVAPSGKSLASL----VDKENHDVKFGAGQ--KELVDYDLDSTPMSVTDVQSPMSVDRSI 162
            :|.||.|....||..::    :::..:.|...|.|  |:..:..:...|...|:|...:....|:
Human    14 ENIDTGVNSKVKSHVTIRRTVLEEIGNRVTTRAAQVAKKAQNTKVPVQPTKTTNVNKQLKPTASV 78

  Fly   163 LGVIQSSDISVGTETGVSPTGRVKELPPRNDRQRFLEVV-------------------QYQMDIL 208
            ..| |...::   ..|.|||.....:...|..|.|.:.:                   .|..||.
Human    79 KPV-QMEKLA---PKGPSPTPEDVSMKEENLCQAFSDALLCKIEDIDNEDWENPQLCSDYVKDIY 139

  Fly   209 EYFRESEKKHRPKPLYMRRQKDISHNMRSILIDWLVEVSEEYKLDTETLYLSVFYLDRFLSQMAV 273
            :|.|:.|......|.:: ..:||:..||:||:||||:|..:::|..||||:.|..:||||....|
Human   140 QYLRQLEVLQSINPHFL-DGRDINGRMRAILVDWLVQVHSKFRLLQETLYMCVGIMDRFLQVQPV 203

  Fly   274 VRSKLQLVGTAAMYIAAKYEEIYPPEVGEFVFLTDDSYTKAQVLRMEQVILKILSFDLCTPTAYV 338
            .|.||||||..|:.:|:||||::.|.:.:||::||::||.:|:..||.:|||.|.|:|..|....
Human   204 SRKKLQLVGITALLLASKYEEMFSPNIEDFVYITDNAYTSSQIREMETLILKELKFELGRPLPLH 268

  Fly   339 FINTYAVLCDMPEKLKYMTLYISELSLMEGETYLQYLPSLMSSASVALARHILGMEMWTPRLEEI 403
            |:...:...::..:...:..|:.||:|::.: .:.|.||.:::|:..|::.:||...|..:.:..
Human   269 FLRRASKAGEVDVEQHTLAKYLMELTLIDYD-MVHYHPSKVAAAASCLSQKVLGQGKWNLKQQYY 332

  Fly   404 TTYKLEDLKTVVLHLCHTHKTAKELNTQ--AMREKYNRDTYKKVAMM 448
            |.|...::..|:.|:........|..|:  |::.||......|::|:
Human   333 TGYTENEVLEVMQHMAKNVVKVNENLTKFIAIKNKYASSKLLKISMI 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 56/125 (45%)
Cyclin_C 334..450 CDD:281044 25/117 (21%)
CCNB2NP_004692.1 Cyclin_N 137..262 CDD:278560 56/125 (45%)
Cyclin_C 264..382 CDD:281044 25/117 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 1 1.000 - - FOG0000121
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100199
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X94
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.