DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycA and CCNG2

DIOPT Version :9

Sequence 1:NP_524030.2 Gene:CycA / 39340 FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_004345.1 Gene:CCNG2 / 901 HGNCID:1593 Length:344 Species:Homo sapiens


Alignment Length:303 Identity:70/303 - (23%)
Similarity:127/303 - (41%) Gaps:54/303 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 MDILEYFRESEKKHRPKPLYMRRQKDIS-------------HNMRSILIDWLVEVSEEYKLDTET 256
            :.:|..:.|.|::.:|      |:|.:|             ..:|:..::.|..::..:...|||
Human    18 LGLLNVYLEQEERFQP------REKGLSLIEATPENDNTLCPGLRNAKVEDLRSLANFFGSCTET 76

  Fly   257 LYLSVFYLDRFLSQMAVVRSKLQLVGTAAMYIAAKY--EEIYPPEVGEFVFLTDDSYTKAQVLRM 319
            ..|:|..|||||:.|.|....|..:|..:..:||:.  |:...|...:.:.::....|.:.:.||
Human    77 FVLAVNILDRFLALMKVKPKHLSCIGVCSFLLAARIVEEDCNIPSTHDVIRISQCKCTASDIKRM 141

  Fly   320 EQVILKILSFDLCTPTAYVFINTY--AVLCDMPEKLKYMTLYISELSLMEGETYLQYLPSLMSSA 382
            |::|.:.|.::|...||..|::.|  .:||...|:.:.::|...|..|......|     :.|.|
Human   142 EKIISEKLHYELEATTALNFLHLYHTIILCHTSERKEILSLDKLEAQLKACNCRL-----IFSKA 201

  Fly   383 SVA-LARHILGMEMWTPRLEEITTYKLEDLKTV----VLHLCHTHKTAKELNTQAMREKYNRDTY 442
            ..: ||..:|.:|             :|.||:|    :|.|...|....:......||..:    
Human   202 KPSVLALCLLNLE-------------VETLKSVELLEILLLVKKHSKINDTEFFYWRELVS---- 249

  Fly   443 KKVAMMESVEMSKDDFDQLCEAYNCKQKEDEHQQ----PDINT 481
            |.:|...|.|..|.|..:|....:.:..::.|..    |::.|
Human   250 KCLAEYSSPECCKPDLKKLVWIVSRRTAQNLHNSYYSVPELPT 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 33/140 (24%)
Cyclin_C 334..450 CDD:281044 28/122 (23%)
CCNG2NP_004345.1 CYCLIN_CCNG2 55..150 CDD:410287 25/94 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 301..320
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146221
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.