DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycA and CLN2

DIOPT Version :9

Sequence 1:NP_524030.2 Gene:CycA / 39340 FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_015067.1 Gene:CLN2 / 855819 SGDID:S000006177 Length:545 Species:Saccharomyces cerevisiae


Alignment Length:196 Identity:45/196 - (22%)
Similarity:80/196 - (40%) Gaps:43/196 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 QYQMDILEYFRESEKKHRPKPLYMRRQKDISH-NMRSILIDWLVEVSEEYKLDTETLYLSVFYLD 265
            :|..:|.........|.:|.|..:.:|.:::. ..||.:|.:|.|:|...::.....:.||...|
Yeast    39 EYHQEISTNVIAQSCKFKPNPKLIDQQPEMNPVETRSNIITFLFELSVVTRVTNGIFFHSVRLYD 103

  Fly   266 RFLSQMAVVRSKLQLVGTAAMYIAAK---------YEEIYP--------------PEVGEFVFLT 307
            |:.|:..|:|.:.:||....:::|||         ...:.|              |.:.|.|...
Yeast   104 RYCSKRIVLRDQAKLVVATCLWLAAKTWGGCNHIINNVVIPTGGRFYGPNPRARIPRLSELVHYC 168

  Fly   308 DDS--YTKAQVLRMEQVILKILSFDLCTPTAYVFINTYAVLCDMPEKLKYMTLYISELSLMEGET 370
            .|.  :.::..|:||:.||..|::::..|    .||.|             .|.:.|..||:.|.
Yeast   169 GDGQVFDESMFLQMERHILDTLNWNIYEP----MINDY-------------VLNVDENCLMQYEL 216

  Fly   371 Y 371
            |
Yeast   217 Y 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 34/151 (23%)
Cyclin_C 334..450 CDD:281044 10/38 (26%)
CLN2NP_015067.1 COG5024 33..524 CDD:227357 45/196 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343508
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.