DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycA and CLN3

DIOPT Version :9

Sequence 1:NP_524030.2 Gene:CycA / 39340 FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_009360.1 Gene:CLN3 / 851191 SGDID:S000000038 Length:580 Species:Saccharomyces cerevisiae


Alignment Length:314 Identity:63/314 - (20%)
Similarity:123/314 - (39%) Gaps:62/314 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 VVQYQMDILE-YFRESEKKHRPKPLY----MRRQKDISHNMRSILIDWLVEVSEEYKLDTETLYL 259
            :.:|..|.|: |||.|   |..:|||    ...|..::..||.::.|:::.......|.|.||:|
Yeast    70 ISEYNNDQLDHYFRLS---HTERPLYNLTNFNSQPQVNPKMRFLIFDFIMYCHTRLNLSTSTLFL 131

  Fly   260 SVFYLDRFLSQMAVVRSKLQLVGTAAMYIAAKYEEIYPPEVGEFVF--LTDDSYTKAQVLRMEQV 322
            :...||::.|:..:.....||:...|::|::|:.:.........|.  |..:.|:..|...||..
Yeast   132 TFTILDKYSSRFIIKSYNYQLLSLTALWISSKFWDSKNRMATLKVLQNLCCNQYSIKQFTTMEMH 196

  Fly   323 ILKILSFDLCTPTAY-VFINTYAVLCDMPEKLKYMTLYISELSLMEG-------ETYLQYLPSLM 379
            :.|.|.:.:|....: .:|:.:              |:.|...|..|       |.::|...:|:
Yeast   197 LFKSLDWSICQSATFDSYIDIF--------------LFQSTSPLSPGVVLSAPLEAFIQQKLALL 247

  Fly   380 SSASVALARHILGMEMWTPRLEEITTYKLEDLKTVVLHLCHTHKTAKELNTQAMREKYNRD---- 440
            ::|:        |..:......:..:..:.::|...:.||.......||:.     ||:|.    
Yeast   248 NNAA--------GTAINKSSSSQGPSLNINEIKLGAIMLCELASFNLELSF-----KYDRSLIAL 299

  Fly   441 ----------TYKKVAMMESVEMSKDDFDQLCEAYNCKQKEDEHQQPDINTKSN 484
                      .|....:.|::.::   .::.|:..:.|..|..:...||....|
Yeast   300 GAINLIKLSLNYYNSNLWENINLA---LEENCQDLDIKLSEISNTLLDIAMDQN 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 35/132 (27%)
Cyclin_C 334..450 CDD:281044 19/137 (14%)
CLN3NP_009360.1 COG5024 35..576 CDD:227357 63/314 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.