DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycA and CYCD1;1

DIOPT Version :9

Sequence 1:NP_524030.2 Gene:CycA / 39340 FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_177178.1 Gene:CYCD1;1 / 843357 AraportID:AT1G70210 Length:339 Species:Arabidopsis thaliana


Alignment Length:299 Identity:71/299 - (23%)
Similarity:134/299 - (44%) Gaps:43/299 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 EVVQYQMDILEYFRESEKKHRPKPLYMRR--QKDISHNMRSILIDWLVEVSEEYKLDTETLYLSV 261
            ||..:..|.:..|.|.|:...|...|:.|  .:.:..:.|...:.|:::|...|.....|.||:|
plant    43 EVDSWPGDSIACFIEDERHFVPGHDYLSRFQTRSLDASAREDSVAWILKVQAYYNFQPLTAYLAV 107

  Fly   262 FYLDRFLSQMAVVRSK---LQLVGTAAMYIAAKYEEIYPPEVGEFVFLTDDSYTKAQVL-RMEQV 322
            .|:||||....:..:.   :||:..|.:.:|||.|||..|.:.:|.........:|:.: |||.:
plant   108 NYMDRFLYARRLPETSGWPMQLLAVACLSLAAKMEEILVPSLFDFQVAGVKYLFEAKTIKRMELL 172

  Fly   323 ILKILSFDLCTPTAYVFINTYAVLCDMPEKLKYMTLYISE-----LSLMEGETYLQYLPSLMSSA 382
            :|.:|.:.|.:.|.:.||:.:|...| |.. .::..:||.     ||.::..::|:|.||.:::|
plant   173 VLSVLDWRLRSVTPFDFISFFAYKID-PSG-TFLGFFISHATEIILSNIKEASFLEYWPSSIAAA 235

  Fly   383 SVALARHIL-----------GMEMWTPRLEE---ITTYKLEDLKTVVLHLCHTHKTAKELNTQAM 433
            ::....:.|           ..|.|...|.:   :..|:|  :|.:.:.       ...|||..:
plant   236 AILCVANELPSLSSVVNPHESPETWCDGLSKEKIVRCYRL--MKAMAIE-------NNRLNTPKV 291

  Fly   434 REKYNRDTYKKVAMMESVEMSK-DDFDQLCEAYNCKQKE 471
            ..|.      :|::..|..::: .|......:..||:::
plant   292 IAKL------RVSVRASSTLTRPSDESSFSSSSPCKRRK 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 37/131 (28%)
Cyclin_C 334..450 CDD:281044 27/134 (20%)
CYCD1;1NP_177178.1 Cyclin_N 50..182 CDD:365896 37/131 (28%)
Cyclin_C 184..308 CDD:367282 28/140 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.