DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycA and AT1G20590

DIOPT Version :9

Sequence 1:NP_524030.2 Gene:CycA / 39340 FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001319051.1 Gene:AT1G20590 / 838648 AraportID:AT1G20590 Length:265 Species:Arabidopsis thaliana


Alignment Length:257 Identity:72/257 - (28%)
Similarity:124/257 - (48%) Gaps:49/257 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 NDRQRFLEVVQYQMDILEYFRESEKKHRPKPL----------------YMRRQKDISHNMRSILI 240
            |....::|....:..|:.:||:.:|:   ||:                :..||.:..::.::   
plant     2 NYSNNYIEHQNKKKTIIIFFRQFKKQ---KPMLRMGVHLVVINKNTFNFFNRQNNYFNSGKT--- 60

  Fly   241 DWLVEVSEEYKLDTETLYLSVFYLDRFLSQMAVVRSKLQLVGTAAMYIAAKYEEIYPPEVGEFVF 305
                              ..:|.:||||:...:||.||||||..|:.:|.||||:..|.|.:.:.
plant    61 ------------------KKIFVIDRFLAVHQIVRKKLQLVGVTALLLACKYEEVSVPVVDDLIL 107

  Fly   306 LTDDSYTKAQVLRMEQVILKILSFDLCTPTAYVFINTYAVLCDMPEKLKYMTLYISELSLMEGET 370
            ::|.:|::.:||.||:::...|.|:...||.|||:..:.......:||:.::.::.||.|:|.| 
plant   108 ISDKAYSRREVLDMEKLMANTLQFNFSLPTPYVFMKRFLKAAQSDKKLEILSFFMIELCLVEYE- 171

  Fly   371 YLQYLPSLMSSASVALARHIL-GMEMWTPRLEEITTYKLEDL-----KTVVLHLCHTHKTAK 426
            .|:||||.::::::..|:..| |.|.|:...|..|.|..|.|     |.|..|  |...|.|
plant   172 MLEYLPSKLAASAIYTAQCTLKGFEEWSKTCEFHTGYNEEQLLACARKMVAFH--HKAGTGK 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 37/141 (26%)
Cyclin_C 334..450 CDD:281044 33/99 (33%)
AT1G20590NP_001319051.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 1 1.000 - - FOG0000121
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X94
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.