DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycA and SDS

DIOPT Version :9

Sequence 1:NP_524030.2 Gene:CycA / 39340 FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001322548.1 Gene:SDS / 838040 AraportID:AT1G14750 Length:619 Species:Arabidopsis thaliana


Alignment Length:422 Identity:93/422 - (22%)
Similarity:179/422 - (42%) Gaps:92/422 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SFQIHQDMSNKENPGIKIPAGVKNTKQPLAVIGG-KAEKNALAPRANFAVLN---GNNNVPRPAG 63
            |..::.:..|||:..:.:.:||:...:..:|.|| ..|:..::..::|...:   |:....:|  
plant   174 SRSLNFESENKESDVVSVISGVEYCSKFGSVTGGADNEEIEISKPSSFVEADSSLGSAKELKP-- 236

  Fly    64 KVQVFRDVRNLNVDENV----------EYGAKKSNVVPVVEQFKTFSVYEDNNDTQVAPSGKSLA 118
            ::::...|.:|...|..          |...::|.:         :|.|.|.:.:...||     
plant   237 ELEIVGCVSDLACSEKFSEEVSDSLDDESSEQRSEI---------YSQYSDFDYSDYTPS----- 287

  Fly   119 SLVDKENHDVKFGAGQKELVDYDLDSTPMSVTDVQSPMSVDRSILGVIQSSD----ISVGTETGV 179
                               :.:|..|.....:...||:|..||:  .:|..:    .::..:.|.
plant   288 -------------------IFFDSGSEFSEKSSSDSPISHSRSL--YLQFKEQFCRSTIPNDFGS 331

  Fly   180 SPTGRVKELPPRNDRQRFLEVVQYQMDILE----YFRESEKKHRPKPLYMR----------RQKD 230
            |....:..           |::::..:.:|    ..||.|:.|    .|||          ....
plant   332 SCEEEIHS-----------ELLRFDDEEVEESYLRLRERERSH----AYMRDCAKAYCSRMDNTG 381

  Fly   231 ISHNMRSILIDWLVEVSEEYKLDTETLYLSVFYLDRFLSQMAVVRSK-LQLVGTAAMYIAAKYEE 294
            :...:|||::.|:|:...:..|..|||:|.|..||||||:.:....: |.|||.|::.:|.:.||
plant   382 LIPRLRSIMVQWIVKQCSDMGLQQETLFLGVGLLDRFLSKGSFKSERTLILVGIASLTLATRIEE 446

  Fly   295 IYP-PEVGEFVFLTDD-SYTKAQVLRMEQVILKILSFDLCTPTAYVFINTY--AVLCDMPEKLKY 355
            ..| ..:.:..|...: .|::.:|:.||.::.::|:|...|||.:.|:..|  |...:...:.|.
plant   447 NQPYNSIRKRNFTIQNLRYSRHEVVAMEWLVQEVLNFKCFTPTIFNFLWFYLKAARANPEVERKA 511

  Fly   356 MTLYISELSLMEGETYLQYLPSLMSSASVALA 387
            .:|.::.||   .:|.|.:.||.:::|.|.||
plant   512 KSLAVTSLS---DQTQLCFWPSTVAAALVVLA 540

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 41/142 (29%)
Cyclin_C 334..450 CDD:281044 17/56 (30%)
SDSNP_001322548.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.