DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycA and CYCD3;2

DIOPT Version :9

Sequence 1:NP_524030.2 Gene:CycA / 39340 FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001331659.1 Gene:CYCD3;2 / 836861 AraportID:AT5G67260 Length:404 Species:Arabidopsis thaliana


Alignment Length:352 Identity:79/352 - (22%)
Similarity:140/352 - (39%) Gaps:101/352 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 FLE-----VVQYQ-MDILEYFRESE--------KKHRPKPLYMRRQKD-ISHNMRSILIDWLVEV 246
            |||     ||::| :.:|:.|...:        |::...|.:..:..| ...:.|...:||::.|
plant    42 FLEKSDESVVKFQFLPLLDMFLWDDDEILSLISKENETNPCFGEQILDGFLVSCRKEALDWVLRV 106

  Fly   247 SEEYKLDTETLYLSVFYLDRFLSQMAVVRSK---LQLVGTAAMYIAAKYEEIYPP-----EVGEF 303
            ...|...:.|..|:|.|.|||::.:.:...|   .|||..|::.:|||.|||..|     :|.|.
plant   107 KSHYGFTSLTAILAVNYFDRFMTSIKLQTDKPWMSQLVAVASLSLAAKVEEIQVPLLLDLQVEEA 171

  Fly   304 VFLTDDSYTKAQVLRMEQVILKILSFDL--CTPTAYV------FINTYAVLCDMPEKLKYMTLYI 360
            .:|    :....:.|||.:||..|.:.:  .||.::.      |.:.:....|...|.:.:.   
plant   172 RYL----FEAKTIQRMELLILSTLQWRMHPVTPISFFDHIIRRFGSKWHQQLDFCRKCERLL--- 229

  Fly   361 SELSLMEGETYLQYLPSLMSSASVALARHILGMEMWTPRLEEITTYKLEDLKTVVLHLCHTHKTA 425
              :|::....:::|.||::::|.:.|.                    .|:||.     |...:..
plant   230 --ISVIADTRFMRYFPSVLATAIMILV--------------------FEELKP-----CDEVEYQ 267

  Fly   426 KELNT--QAMREKYNRDTYK--------KVAMMESVEMSKD----DFDQLC-EAYN--------- 466
            .::.|  :..:||.| :.|:        |..||..|:....    |||... .::|         
plant   268 SQITTLLKVNQEKVN-ECYELLLEHNPSKKRMMNLVDQDSPSGVLDFDDSSNSSWNVSTTASVSS 331

  Fly   467 --------CKQKEDEHQQ---PDINTK 482
                    .|::..:.||   |.||.|
plant   332 SSSSPEPLLKRRRVQEQQMRLPSINRK 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 38/144 (26%)
Cyclin_C 334..450 CDD:281044 22/131 (17%)
CYCD3;2NP_001331659.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.