DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycA and CYCD4;1

DIOPT Version :9

Sequence 1:NP_524030.2 Gene:CycA / 39340 FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001190620.1 Gene:CYCD4;1 / 836667 AraportID:AT5G65420 Length:318 Species:Arabidopsis thaliana


Alignment Length:249 Identity:68/249 - (27%)
Similarity:114/249 - (45%) Gaps:51/249 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 TETGVSPTGRVKELPPRNDRQRFLEVVQYQM--------DILEYFRESEKKHRPKPLYMRRQK-- 229
            ||:.|...|.:.:..|       :|:...||        :|:....|.||:|.|...|::|.:  
plant    13 TESNVDDEGMIVDETP-------IEISIPQMGFSQSESEEIIMEMVEKEKQHLPSDDYIKRLRSG 70

  Fly   230 DISHNM-RSILIDWLVEVSEEYKLDTET----------LYLSVFYLDRFLSQMAVVRSK---LQL 280
            |:..|: |...::|:.::....:.|.|.          ..|::.|||||||...:...|   |||
plant    71 DLDLNVGRRDALNWIWKIRGLCRTDREACEVHQFGPLCFCLAMNYLDRFLSVHDLPSGKGWILQL 135

  Fly   281 VGTAAMYIAAKYEEIYPP-----EVG--EFVFLTDDSYTKAQVLRMEQVILKILSFDL--CTPTA 336
            :..|.:.:|||.||...|     :||  :|||      ....|.|||.::|..|.:.|  .||.:
plant   136 LAVACLSLAAKIEETEVPMLIDLQVGDPQFVF------EAKSVQRMELLVLNKLKWRLRAITPCS 194

  Fly   337 YV--FINTYAVLCDMPEKLKYMTLYISEL-SLMEGETYLQYLPSLMSSASVALA 387
            |:  |:...: .||.......::..:..: |..:|..:|::.||.: :|:|||:
plant   195 YIRYFLRKMS-KCDQEPSNTLISRSLQVIASTTKGIDFLEFRPSEV-AAAVALS 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 45/150 (30%)
Cyclin_C 334..450 CDD:281044 14/57 (25%)
CYCD4;1NP_001190620.1 Cyclin_N 45..188 CDD:278560 44/148 (30%)
Cyclin_C 191..>282 CDD:281044 15/58 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.