DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycA and CYCD4;2

DIOPT Version :9

Sequence 1:NP_524030.2 Gene:CycA / 39340 FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_196606.3 Gene:CYCD4;2 / 830908 AraportID:AT5G10440 Length:298 Species:Arabidopsis thaliana


Alignment Length:200 Identity:59/200 - (29%)
Similarity:101/200 - (50%) Gaps:27/200 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 DILEYFRESEKKHRPKPLYMRRQK--DISHNMRSILIDWLVEVSEEYKLDTETLYLSVFYLDRFL 268
            :|:....|.|::|.|:..|::|.:  |:..|:|...:.|:.:..||.:.....:.|::.||||||
plant    37 EIVREMIEKERQHSPRDDYLKRLRNGDLDFNVRIQALGWIWKACEELQFGPLCICLAMNYLDRFL 101

  Fly   269 SQMAVVRSK---LQLVGTAAMYIAAKYEEIYPPE-----VGEFVFLTDDSYTKAQVLRMEQVILK 325
            |...:...|   :||:..|.:.:|||.||...||     ||..:|:    :....|.|||.::|.
plant   102 SVHDLPSGKAWTVQLLAVACLSLAAKIEETNVPELMQLQVGAPMFV----FEAKSVQRMELLVLN 162

  Fly   326 ILSFDL--CTPTAYV-----FINTYAVLCDMPEKLKYMTLYISEL-SLMEGETYLQYLPSLMSSA 382
            :|.:.|  .||.:||     .||.|    |.....:.:|..:..: |..:|..:|::..|.: :|
plant   163 VLRWRLRAVTPCSYVRYFLSKINGY----DQEPHSRLVTRSLQVIASTTKGIDFLEFRASEI-AA 222

  Fly   383 SVALA 387
            :|||:
plant   223 AVALS 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 42/137 (31%)
Cyclin_C 334..450 CDD:281044 16/59 (27%)
CYCD4;2NP_196606.3 Cyclin_N 37..169 CDD:278560 41/135 (30%)
Cyclin_C 171..281 CDD:281044 17/61 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.