DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycA and CYCD6;1

DIOPT Version :9

Sequence 1:NP_524030.2 Gene:CycA / 39340 FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_192236.1 Gene:CYCD6;1 / 828000 AraportID:AT4G03270 Length:302 Species:Arabidopsis thaliana


Alignment Length:309 Identity:69/309 - (22%)
Similarity:130/309 - (42%) Gaps:83/309 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 EVVQYQMDILEYFRESEKKHRPKPLYMRRQKDISH--NMRSILIDWLVEVSEEYKLDTETLYLSV 261
            |.:.:.:.::|:      :|.|...|....|..:.  :.|:..|..:.:.|.::. |....||:|
plant    25 ETLPHSLFLVEF------QHMPSSHYFHSLKSSAFLLSNRNQAISSITQYSRKFD-DPSLTYLAV 82

  Fly   262 FYLDRFLSQMAVVRSK---LQLVGTAAMYIAAKYEEIYPPEVGEFVFLTDDSYTKAQVL-RMEQV 322
            .|||||||...:.:||   |:|:..:.:.::||..:   |::.......:..:..||:: |||.|
plant    83 NYLDRFLSSEDMPQSKPWILKLISLSCVSLSAKMRK---PDMSVSDLPVEGEFFDAQMIERMENV 144

  Fly   323 ILKILSFDLCTPTAYVFINTYAVLCDMPEK--------LKYMTLYISEL--SLMEGETYLQYLPS 377
            ||..|.:.:.:.|.:.|:..:..|.::.|:        ||..|   |:|  ||....::|::.||
plant   145 ILGALKWRMRSVTPFSFLAFFISLFELKEEDPLLLKHSLKSQT---SDLTFSLQHDISFLEFKPS 206

  Fly   378 LMSSASVALARHILGMEMWTPRLEEITTYKLEDLKTVVLHLCHTHKTAKELNTQAMREKYNRDTY 442
            :::.|::..|.                           ..||       .|.......:.|:.||
plant   207 VIAGAALLFAS---------------------------FELC-------PLQFPCFSNRINQCTY 237

  Fly   443 KKVAMMESVEMSKDDFDQLCEAYNCKQKED----EHQQPDINTKSNVNL 487
                      ::|   |:|.|.|...|:.|    |::.   :|::.||:
plant   238 ----------VNK---DELMECYKAIQERDIIVGENEG---STETAVNV 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 35/131 (27%)
Cyclin_C 334..450 CDD:281044 22/125 (18%)
CYCD6;1NP_192236.1 Cyclin_N 29..154 CDD:278560 35/134 (26%)
Cyclin_C 156..>252 CDD:281044 27/145 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.