DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycA and CYCD3;3

DIOPT Version :9

Sequence 1:NP_524030.2 Gene:CycA / 39340 FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_190576.1 Gene:CYCD3;3 / 824169 AraportID:AT3G50070 Length:361 Species:Arabidopsis thaliana


Alignment Length:216 Identity:52/216 - (24%)
Similarity:97/216 - (44%) Gaps:39/216 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 RSILIDWLVEVSEEYKLDTETLYLSVFYLDRFLSQMAVVRSK---LQLVGTAAMYIAAKYEEIYP 297
            |...:||:.:|...|..::.|..|:|.|.|||::.......|   .||...|.:.:|||.|||..
plant    86 REKALDWIFKVKSHYGFNSLTALLAVNYFDRFITSRKFQTDKPWMSQLTALACLSLAAKVEEIRV 150

  Fly   298 PEVGEFVFLTDDSYTKAQ-------VLRMEQVILKILSFDL--CTPTAYV--FINTYAVLCDMPE 351
            |      ||.|....:|:       :.|||.::|..|.:.:  .||.::.  .|..|:.      
plant   151 P------FLLDFQVEEARYVFEAKTIQRMELLVLSTLDW
RMHPVTPISFFDHIIRRYSF------ 203

  Fly   352 KLKYMTLYISE-----LSLMEGETYLQYLPSLMSSA-SVALARHILGMEMWTPRLEEITTYKLED 410
            |..:...::|.     ||::....:|.:.||::::| .|::.|.:...:....:.:.:|..|::.
plant   204 KSHHQLEFLSRCESLLLSIIPDSRFLSFSPSVLATAIMVSVIRDLKMCDEAVYQSQLMTLLKVDS 268

  Fly   411 LKTVVLHLCH----THKTAKE 427
            .|   ::.|:    .|..:|:
plant   269 EK---VNKCYELVLDHSPSKK 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 32/107 (30%)
Cyclin_C 334..450 CDD:281044 19/106 (18%)
CYCD3;3NP_190576.1 CYCLIN_AtCycD-like_rpt1 85..183 CDD:410246 32/102 (31%)
CYCLIN_AtCycD-like_rpt2 188..278 CDD:410247 18/98 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.