DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycA and CYCB1;4

DIOPT Version :9

Sequence 1:NP_524030.2 Gene:CycA / 39340 FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_180244.1 Gene:CYCB1;4 / 817217 AraportID:AT2G26760 Length:387 Species:Arabidopsis thaliana


Alignment Length:274 Identity:103/274 - (37%)
Similarity:159/274 - (58%) Gaps:11/274 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 DRQRFLEVVQYQMDILEYFRESEKKHRPKPLYMRRQKDISHNMRSILIDWLVEVSEEYKLDTETL 257
            |....|..|:|..||.:::|..|::...|. |:..|.:|:..||||||||||:|..:::|..|||
plant   120 DANNELAAVEYVEDIFKFYRTVEEEGGIKD-YIGSQPEINEKMRSILIDWLVDVHRKFELMPETL 183

  Fly   258 YLSVFYLDRFLSQMAVVRSKLQLVGTAAMYIAAKYEEIYPPEVGEFVFLTDDSYTKAQVLRMEQV 322
            ||::..:|||||...|.|.:|||:|..||.||.|||||:.|||.:||.::|::|.:.|||.||:.
plant   184 YLTINLVDRFLSLTMVHRRELQLLGLGAMLIACKYEEIWAPEVNDFVCISDNAYNRKQVLAMEKS 248

  Fly   323 ILKILSFDLCTPTAYVFINTY---AVLCDMPEKLKYMTLYISELSLMEGETYLQYLPSLMSSASV 384
            ||..:.:.:..||.|||:..|   ||.||  .:::.:..|::||.||:....:...||::::::|
plant   249 ILGQVEWYITVPTPYVFLARYVKAAVPCD--AEMEKLVFYLAELGLMQYPIVVLNRPSMLAASAV 311

  Fly   385 ALARHIL-GMEMWTPRLEEITTYKLEDLKTVVLHLCHTHKTAKELNTQAMREKYNRDTYKKVAMM 448
            ..||.|| ....||..|:..|.|..:::......|.....:|.|....|:.:||:.....:||::
plant   312 YAARQILKKTPFWTETLKHHTGYSEDEIMEHAKMLMKLRDSASESKLIAVFKKYSVSENAEVALL 376

  Fly   449 ESVEMSKDDFDQLC 462
            .|:    |||...|
plant   377 PSL----DDFSVSC 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 59/125 (47%)
Cyclin_C 334..450 CDD:281044 35/119 (29%)
CYCB1;4NP_180244.1 CYCLIN_AtCycB-like_rpt1 110..255 CDD:410270 63/135 (47%)
CYCLIN_AtCycB-like_rpt2 260..377 CDD:410215 35/118 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 1 1.000 - - FOG0000121
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X94
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.