DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycA and CCNJL

DIOPT Version :9

Sequence 1:NP_524030.2 Gene:CycA / 39340 FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_078841.3 Gene:CCNJL / 79616 HGNCID:25876 Length:435 Species:Homo sapiens


Alignment Length:296 Identity:64/296 - (21%)
Similarity:116/296 - (39%) Gaps:91/296 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 RQKDI------SHN----MRSILIDWLVEVSEEYKLDTETLYLSVFYLDRFLSQMAVVRSK---- 277
            |:|::      :|:    .|...:|.|..:|...:|.....:|:|:.||.|:.:..|..||    
Human    20 REKELKLPTFRAHSPLLKSRRFFVDILTLLSSHCQLCPAARHLAVYLLDHFMDRYNVTTSKQLYT 84

  Fly   278 ------------------------------LQLVGTAAMYIAAKYEEIYPPEVGEFVFLTDD--- 309
                                          |.|.|::....:|.:....||:|.|.....:|   
Human    85 VAVSCLLLANGVSLLSPRLKCSGMISAHCNLHLPGSSNSPASAPHPPPTPPQVAETTGKFEDRED 149

  Fly   310 -------------------SYTKAQVLRMEQVILKILSFDLCTPTAYVFINTYAVLCDMPEK--- 352
                               :.||.::|..|.::|:..|::||.||...|:: |.:|..:.:|   
Human   150 HVPKLEQINSTRILSSQNFTLTKKELLSTELLLLEAFSWNLCLPTPAHFLD-YYLLASVSQKDHH 213

  Fly   353 ---------------LKYMTLYISELSLMEGETYLQYLPSLMSSASVALARHILGME-MWTPRLE 401
                           ||....|..|::|.: ..:.::.||::::|.|..:|..|.:. .||..|:
Human   214 CHTWPTTCPRKTKECLKEYAHYFLEVTLQD-HIFYKFQPSVVAAACVGASRICLQLSPYWTRDLQ 277

  Fly   402 EITTYKLEDLKTVVLHLCHTH----KTAKELNTQAM 433
            .|::|.||.|.|.:..|...:    |.|..:.:||:
Human   278 RISSYSLEHLSTCIEILLVVYDNVLKDAVAVKSQAL 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 31/170 (18%)
Cyclin_C 334..450 CDD:281044 31/123 (25%)
CCNJLNP_078841.3 CYCLIN 14..>93 CDD:294043 16/72 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..142 5/21 (24%)
Cyclin_C 193..>295 CDD:281044 26/103 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.