DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycA and Ccnd1

DIOPT Version :9

Sequence 1:NP_524030.2 Gene:CycA / 39340 FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:XP_008758390.1 Gene:Ccnd1 / 58919 RGDID:68384 Length:317 Species:Rattus norvegicus


Alignment Length:218 Identity:61/218 - (27%)
Similarity:112/218 - (51%) Gaps:32/218 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 NDRQRFLEVVQYQMDILEYFRESEKKHRPKPLYMR-RQKDISHNMRSILIDWLVEVSEEYKLDTE 255
            |||            :|....::|:...|...|.: .|::|..:||.|:..|::||.||.|.:.|
  Rat    24 NDR------------VLRAMLKTEETCAPSVSYFKCVQREIVPSMRKIVATWMLEVCEEQKCEEE 76

  Fly   256 TLYLSVFYLDRFLSQMAVVRSKLQLVGTAAMYIAAKYEEIYPPEVGEFVFLTDDSYTKAQVLRME 320
            ...|::.|||||||...:.:|:|||:|...|::|:|.:|..|....:....||:|....::|:||
  Rat    77 VFPLAMNYLDRFLSLEPLKKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQME 141

  Fly   321 QVILKILSFDLCTPTAYVFINTYAVLCDMPEK-------LKYMTLYISELSLMEGETYLQYL--- 375
            .:::..|.::|...|.:.||..:  |..|||.       .|:...:::..:     |.::::   
  Rat   142 LLLVNKLKWNLAAMTPHDFIEHF--LSKMPEADENKQIIRKHAQTFVALCA-----TDVKFISNP 199

  Fly   376 PSLMSSASVALARHILGMEMWTP 398
            ||::::.||..|  :.|:.:.:|
  Rat   200 PSMVAAGSVVAA--MQGLNLGSP 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 41/126 (33%)
Cyclin_C 334..450 CDD:281044 16/75 (21%)
Ccnd1XP_008758390.1 Cyclin_N 31..153 CDD:278560 40/121 (33%)
Cyclin_C 156..291 CDD:281044 16/74 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339992
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.