DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycA and ccnj

DIOPT Version :9

Sequence 1:NP_524030.2 Gene:CycA / 39340 FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:XP_021336586.1 Gene:ccnj / 557593 ZFINID:ZDB-GENE-100721-4 Length:355 Species:Danio rerio


Alignment Length:252 Identity:73/252 - (28%)
Similarity:119/252 - (47%) Gaps:33/252 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 DILEYFRESEKKHRPKPLYMRRQKDISHNMRSILIDWLVEVSEEYKLDTETLYLSVFYLDRFLSQ 270
            ||.:..|..|.:   .|.|..:...:|  :|....|.:..||..:||.....:|:|:.||.|:.:
Zfish    15 DIYQALRYKELR---LPAYKGQSPQLS--LRRYFADLIAIVSNRFKLCPAARHLAVYLLDLFMDR 74

  Fly   271 MAVVRSKLQLVGTAAMYIAAKYEEIYP--PEVGEFVFLTDDS-----YTKAQVLRMEQVILKILS 328
            ..:...:|.:|..:.:.:|:|:||...  |::.....|...|     .||..:|.||.::|:...
Zfish    75 YDISVQQLHMVALSCLLLASKFEEREDRVPKLEALNSLGCMSSMNLVLTKPGLLHMELLLLETFQ 139

  Fly   329 FDLCTPTAYVFINTY--------------AVLCDMPEKLKYMTLYIS---ELSLMEGETYLQYLP 376
            ::|..|||..||..|              .:.| |.:.:.||:.|..   |:||.: ..:|:::|
Zfish   140 WNLYLPTAAHFIEYYLPVAVNETDLHDGWPMTC-MEKTMLYMSKYADYFLEVSLQD-HAFLRFVP 202

  Fly   377 SLMSSASVALARHILGME-MWTPRLEEITTYKLEDLKTVVLHLCHTHKT-AKELNTQ 431
            ||:|:|.||.:|.||.:. .|.|||:.::.|..|.|...|..|...|.: .||.|.|
Zfish   203 SLVSAACVASSRVILRLSPSWPPRLQRLSAYSWEQLLPCVQKLLIAHDSDVKEANKQ 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 33/132 (25%)
Cyclin_C 334..450 CDD:281044 39/117 (33%)
ccnjXP_021336586.1 Cyclin_N2 <10..246 CDD:330468 67/237 (28%)
Cyclin_C 145..>249 CDD:308564 34/105 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579799
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.