DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycA and ccni

DIOPT Version :9

Sequence 1:NP_524030.2 Gene:CycA / 39340 FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_998386.1 Gene:ccni / 406239 ZFINID:ZDB-GENE-040426-2898 Length:355 Species:Danio rerio


Alignment Length:318 Identity:74/318 - (23%)
Similarity:129/318 - (40%) Gaps:68/318 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 RESE--KKHRP-KPLYMRRQKDISHNMRSILIDWLVEVSEEYKLDTETLYLSVFYLDRFLSQMAV 273
            ||::  |.:.| ||  ..:..|||...|...:.||.:|..:.||..|||.|::..||||||.:..
Zfish    22 REAKLWKVYVPKKP--TNQDTDISPEKRDEAVRWLRDVHSQLKLYPETLCLAIGILDRFLSTIKA 84

  Fly   274 VRSKLQLVGTAAMYIAAK--YEEIYPPEVGEFVFLTDDSYTKAQVLRMEQVILKILSFDLCTPTA 336
            ....|:.:..:..::|||  .|:...|.:.|....:....:.:::||||:::|..|::||.:.||
Zfish    85 RPKYLRCIAISCFFLAAKTSEEDERIPSLRELASSSKCGCSPSEILRMERIVLDKLNWDLHSATA 149

  Fly   337 ----YVFINTYAVLCDMPEKLKYMTLYISELSLMEGETYL--QYLPSLMSSASVALARHILGMEM 395
                |:| :...:.|    |...::..:|.|:.......|  |....|..:|.:.:...:|.:.:
Zfish   150 LDFLYIF-HAMVLSC----KSGRLSAALSGLNPSHHVALLTQQLFHCLAHNALLQVRGSLLSLGL 209

  Fly   396 WTPRLE-----------------EITTYKLEDLKTVVLHLCHTHKTAKELNTQAM---------- 433
            .|..||                 :|.:.:|...:.:|.....||..:...||..:          
Zfish   210 ITLELEKLCPDWLALTVDLLHRLQIDSSQLICCRELVARCLSTHTASLPPNTVYICRPLPEPRDE 274

  Fly   434 ---------------REKYNRDTYKKVAMMESVEMSKDDFDQLCEAYNCKQKEDEHQQ 476
                           ...::|...:||..||..|.    :|.:...||    |:..|:
Zfish   275 GVLHVSLAPTAPSDPNSTHSRSAKRKVEQMEVDEY----YDGIKRLYN----EENPQE 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 39/124 (31%)
Cyclin_C 334..450 CDD:281044 27/163 (17%)
ccniNP_998386.1 Cyclin_N 31..144 CDD:278560 35/114 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.