DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycA and LOC394448

DIOPT Version :9

Sequence 1:NP_524030.2 Gene:CycA / 39340 FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001182327.1 Gene:LOC394448 / 394448 -ID:- Length:390 Species:Xenopus tropicalis


Alignment Length:249 Identity:84/249 - (33%)
Similarity:147/249 - (59%) Gaps:10/249 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 YQMDILEYFRESEKKHRPKPLYMRRQKDISHNMRSILIDWLVEVSEEYKLDTETLYLSVFYLDRF 267
            |..||..|.|:.|.:...:|.|:... :::..||:||:|||::|..:::|..||||:::..:|||
 Frog   126 YVKDIYTYLRQLEVQQAVRPRYLHGM-EVNERMRAILVDWLIQVHLKFQLLQETLYMAIAIMDRF 189

  Fly   268 LSQMAVVRSKLQLVGTAAMYIAAKYEEIYPPEVGEFVFLTDDSYTKAQVLRMEQVILKILSFDLC 332
            |....:.||||||||..:::||:||||:|.||:.:||::||::|:|||:..||.:|||.|:|||.
 Frog   190 LQGQPISRSKLQLVGVTSLFIASKYEEMYYPEISDFVYITDNTYSKAQIREMEMMILKELNFDLG 254

  Fly   333 TPTAYVFINTYAVLCDMPEKLKYMTLYISELSLMEGETYLQYLPSLMSSASVALARHILGMEMWT 397
            .|....|:...:..|........:..|..||:|::.: .:.:.||.:::|::.|.:.:|.:..|.
 Frog   255 RPLPLNFLRRASKCCSADAGQHTLAKYFMELTLLDYD-MVHFHPSAIAAAALCLTQKVLNIGTWD 318

  Fly   398 PRLEEITTYKLEDLKTVVLHLCHTHKTAKELNTQ-----AMREKYNRDTYKKVA 446
            ..|:..|.|..:||   :|.:.|..|...::|..     :::.||:.....|::
 Frog   319 ATLQFYTGYSQDDL---ILPMKHMAKVIVQVNQNQTKFLSVKNKYSSSKLLKIS 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 57/125 (46%)
Cyclin_C 334..450 CDD:281044 25/118 (21%)
LOC394448NP_001182327.1 COG5024 <92..371 CDD:227357 84/249 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 1 1.000 - - FOG0000121
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X94
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.