DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycA and Ccnjl

DIOPT Version :9

Sequence 1:NP_524030.2 Gene:CycA / 39340 FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001038995.1 Gene:Ccnjl / 380694 MGIID:2685723 Length:387 Species:Mus musculus


Alignment Length:226 Identity:57/226 - (25%)
Similarity:108/226 - (47%) Gaps:39/226 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 RQKDI------SHN----MRSILIDWLVEVSEEYKLDTETLYLSVFYLDRFLSQMAVVRSK-LQL 280
            |:|::      :|:    .|...:|.|..:|....|.....:|:::.||.|:.|..:..|| |..
Mouse    19 REKELKLPTFRAHSPLLKSRRFFVDILTLLSRHCHLCPSARHLAIYLLDHFMDQYNITTSKQLYT 83

  Fly   281 VGTAAMYIAAKYE--EIYPP---EVGEFVFLTDDSY--TKAQVLRMEQVILKILSFDLCTPTAYV 338
            |..:.:.:|:|:|  |...|   ::.....|:..::  ||.::|..|.::|:..|:|||.||...
Mouse    84 VAVSCLLLASKFEDREDRVPKLE
QINNTRILSSQNFSLTKKELLTTELLLLEAFSWDLCLPTPAH 148

  Fly   339 FINTYAVLCDMPEK------------------LKYMTLYISELSLMEGETYLQYLPSLMSSASVA 385
            |:: |.:|..:.:|                  ||....|..|::|.: ..:.::.||::::|.|.
Mouse   149 FLD-YYLLASISQKDHHCHAWPTTCLRKTKECLKEYAHYFLEVTLQD-HIFYKFQPSVVAAACVG 211

  Fly   386 LARHILGME-MWTPRLEEITTYKLEDLKTVV 415
            .:|..|.:. .||..|:.:::|.||.|.|.:
Mouse   212 ASRICLQLSPYWTRDLQRVSSYSLEHLSTCI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 30/122 (25%)
Cyclin_C 334..450 CDD:281044 25/101 (25%)
CcnjlNP_001038995.1 CYCLIN 13..>106 CDD:294043 22/86 (26%)
Cyclin_C 144..>246 CDD:281044 25/101 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.