DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycA and CYCJ18

DIOPT Version :9

Sequence 1:NP_524030.2 Gene:CycA / 39340 FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001030944.1 Gene:CYCJ18 / 3768365 AraportID:AT2G01905 Length:234 Species:Arabidopsis thaliana


Alignment Length:190 Identity:43/190 - (22%)
Similarity:86/190 - (45%) Gaps:30/190 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 DISHNMRSILIDWLVEVSEEYKLDTETLY--LSVFY------LDRFLSQ--------MAVVRSKL 278
            :|.| :|..|:::|::.:...:|.....|  ||:|:      |.|||.:        ..:..|.|
plant     4 EIGH-LRRRLVEFLIQSTTLLELPPIVKYSALSLFFDRFRPNLVRFLQKKKAEHWLLQPLNESNL 67

  Fly   279 QLVGTAAMYIAAKYE-----EIYP-PEVGEFVFLTDDSYTKAQVLRMEQVILKILSFDLCT-PTA 336
            ||....:::|:.|..     .::. ...|:.| :|:..:.....|..|.|.||:|.|::.| ..|
plant    68 QLFVLISIWISCKMHCTRGLSVHSLKSFGDKV-ITEQLFMVRDFLDAELVFLKVLKFEIGTLNIA 131

  Fly   337 YVFINTYAV----LCDMPEKLKY-MTLYISELSLMEGETYLQYLPSLMSSASVALARHIL 391
            |..:....:    :..:.|:|.: ..:.:.:|...:.:|.|.|..|...:||:.::.:|:
plant   132 YTRLEDLLIQFKEVAKVGEQLNFEACMDMMDLLYEKEDTSLLYQSSKSLAASILVSSYII 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 30/123 (24%)
Cyclin_C 334..450 CDD:281044 12/63 (19%)
CYCJ18NP_001030944.1 CYCLIN <7..126 CDD:381775 29/120 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.