DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycA and Ccne2

DIOPT Version :9

Sequence 1:NP_524030.2 Gene:CycA / 39340 FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001102126.1 Gene:Ccne2 / 362485 RGDID:1307783 Length:405 Species:Rattus norvegicus


Alignment Length:288 Identity:79/288 - (27%)
Similarity:132/288 - (45%) Gaps:72/288 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 DISHNMRSILIDWLVEVSEEYKLDTETLYLSVFYLDRF-LSQMAVVRSKLQLVGTAAMYIAAKYE 293
            |:...|||||:|||:||.|.|.|..||.||:..:.||| |:|..|.::.|||:|..:::||:|.|
  Rat   137 DLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDVNKNMLQLIGITSLFIASKLE 201

  Fly   294 EIYPPEVGEFVFLTDDSYTKAQVLRMEQVILKILSFDLCTPTAYVFINTYA---VLCDMPEKL-- 353
            |||.|::.||.::||.:.::..:|:||..|||.|.::||..|...::|.:.   .:.|:|:.|  
  Rat   202 EIYAPKLQEFAYVTDGACSEVDILKMELNILKALKW
ELCPVTVISWLNLFLQVDAVKDIPKVLLP 266

  Fly   354 -----------KYMTLYISELSLMEGETYLQYLPSLMSSASVALARHILGMEMWTPRLEEITTYK 407
                       :.:.|.|..:..:|.:..:....:|....|:.:.:...|:| |           
  Rat   267 QYSQETFIQIAQLLDLCILAIDSLEFQYRILAAAALCHFTSIEVVKKASGLE-W----------- 319

  Fly   408 LEDLKTVVLHLCHTHKTAKELNTQAMREKYNRDTYKKVAMMESVEMSKDDFDQLCEAYNCKQKED 472
             :|:...|..:.......|.::...::      |:||:.|                       ||
  Rat   320 -DDISECVDWMVPFVSVVKSVSPVKLK------TFKKIPM-----------------------ED 354

  Fly   473 EHQQPDINTKSN----------VNLFYK 490
            .|   :|.|.:|          ||:|.|
  Rat   355 RH---NIQTHTNYLALLNEVNYVNIFRK 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 47/102 (46%)
Cyclin_C 334..450 CDD:281044 20/131 (15%)
Ccne2NP_001102126.1 CYCLIN_SF 101..237 CDD:424085 47/99 (47%)
CYCLIN_SF 241..329 CDD:424085 15/100 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339982
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.