DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycA and CycE

DIOPT Version :9

Sequence 1:NP_524030.2 Gene:CycA / 39340 FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001246037.1 Gene:CycE / 34924 FlyBaseID:FBgn0010382 Length:712 Species:Drosophila melanogaster


Alignment Length:352 Identity:93/352 - (26%)
Similarity:159/352 - (45%) Gaps:73/352 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KNTKQPLAVIGGKAEKNALAPRANFAVLNGNNNVPRPAGKVQVFRDVRNLNVDENVEYGAKKSNV 89
            ::|::.|::....||..:.||.:  .:.:..::.|.|        |..:......|.|.|::...
  Fly   168 QSTQELLSIRSSPAEDLSEAPHS--PLPDSPDSPPSP--------DRGSKQTPVVVRYAAEQVVT 222

  Fly    90 VPVVEQFKT------------FSVYEDNNDTQVAPSGKSLASLVDKENHDVKF----------GA 132
            ..||.| ||            :|..||:.|.            |::|:.||:.          |.
  Fly   223 STVVTQ-KTEDDDLLDDSCEDYSYDEDDEDD------------VEEEDDDVEIYSSTISPASSGC 274

  Fly   133 GQKELVDYD-LDSTPMSVTDVQSPMSVDRSILGVIQSSDISVGTETGVSPT--GRVKELPPRNDR 194
            .|::.|:.: ....|.....:..|:            ||:.:...|.:||.  ..:::.|     
  Fly   275 SQQQAVNGERTPGLPKHQEQIHHPV------------SDLMINMRTPMSPAVENGLRQCP----- 322

  Fly   195 QRFLEVVQY--QMDILEYF-RESEKKHRPKPLYMRRQ-KDISHNMRSILIDWLVEVSEEYKLDTE 255
               |..:.:  ..|:.... ...|:..|.:.:.|..| ..:...||:||:|||:||.|.|||..|
  Fly   323 ---LPALAWANAADVWRLMCHRDEQDSRLRSISMLEQHPGLQPRMRAILLDWLIEVCEVYKLHRE 384

  Fly   256 TLYLSVFYLDRFLS-QMAVVRSKLQLVGTAAMYIAAKYEEIYPPEVGEFVFLTDDSYTKAQVLRM 319
            |.||:|.||||:|. ...|.::.|||:|...:::|||.||||||::|||.::||.:.|:..:|..
  Fly   385 TFYLAVDYLDRYLHVAHKVQKTHLQLIGITCLFVAAKVEEIYPPKIGEFAYVTDGACTERDILNH 449

  Fly   320 EQVILKILSFDLCTPTAYVFINTYAVL 346
            |:::|:.|.:|:...|...::..|..|
  Fly   450 EKILLQALDWDISPITITGWLGVYMQL 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 53/128 (41%)
Cyclin_C 334..450 CDD:281044 3/13 (23%)
CycENP_001246037.1 Cyclin_N 333..462 CDD:278560 53/128 (41%)
Cyclin_C <517..>571 CDD:281044
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447483
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.