DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycA and CycD

DIOPT Version :9

Sequence 1:NP_524030.2 Gene:CycA / 39340 FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_523355.2 Gene:CycD / 32551 FlyBaseID:FBgn0010315 Length:477 Species:Drosophila melanogaster


Alignment Length:432 Identity:98/432 - (22%)
Similarity:171/432 - (39%) Gaps:86/432 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 DKENHDVKFGAGQKELV------------DYDLDSTPMSVTDVQSPMSVDRSILGVIQSSDISVG 174
            |.:|:.|.  ...||||            ...|:..|........|.:..:|    |||....:.
  Fly    53 DAQNNAVV--CNMKELVYIYASVDSAAKNPEQLEPPPPPPPPPPPPPTATQS----IQSYPRYIS 111

  Fly   175 TETGVSPTGRVKEL------PPRNDRQRFL--EVVQYQMDILEYFRESEKKHRPKP-LYMRRQKD 230
            .|...|...|:.|.      ||..|.....  :...|....||.|.:.|:||...| .|...|||
  Fly   112 QEPPTSHCQRLDERLTTTADPPATDNVNTAIGDPTLYSDRCLENFLKVEEKHHKIPDTYFSIQKD 176

  Fly   231 ISHNMRSILIDWLVEVSEEYKLDTETLYLSVFYLDRFLSQMAVVRSKLQLVGTAAMYIAAKYEEI 295
            |:..||.|:.:|::||..|.....|.:.|::.|:|||||..:|.:::||::..|.:.:|:|..| 
  Fly   177 ITPPMRKIVAEWMMEVCAEENCQEEVVLLALNYMDRFLSSKSVRKTQLQILAAACLLLASKLRE- 240

  Fly   296 YPP----EVGEFVFLTDDSYTKAQVLRMEQVILKILSFDLCTPTAYVFINTYAVLCDMPEKLKYM 356
             |.    .|...|..||:|..|..:::.|..:|..|.:||.:.|...|:....:...:..| .:.
  Fly   241 -PSCRALSVDLLVVYTDNSIYKDDLIKWELYVLSRLGWDLSSVTPLDFLELLMMRLPIGSK-NFP 303

  Fly   357 TLYISE--------LSLMEGE-TYLQYLPSLMSSASVALARHILGMEMWTPR-----------LE 401
            .:.|.:        :||...| .:.::..|.::::|:|.:.:  |:: |..|           :.
  Fly   304 DINIGKVRGHAQAFISLAAKEHKFAKFSASTIAASSIAASMN--GLK-WHLRSGHNLHFLLSLMT 365

  Fly   402 EITTYKLEDLKTVVLHLCHTHK-------------TAKELNTQAMREKYN------------RDT 441
            ::|:.:...::..:||:....|             ..||::|...:.::.            |..
  Fly   366 DLTSVEQAQVRDCMLHMEDIFKEHSRNLEPFLVNIDPKEMSTLYYKRRFQIHQSQHLSQISIRPL 430

  Fly   442 YKKVAMMESVE--MSKDDFDQLC--EAYNCKQKEDEHQQPDI 479
            ....|..|.||  ..:.:|....  ..:.||.:.....|.:|
  Fly   431 PLPKAPAECVEQHQQQHNFGSAAPHRTHTCKMQAQAQAQNEI 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 45/130 (35%)
Cyclin_C 334..450 CDD:281044 22/160 (14%)
CycDNP_523355.2 Cyclin_N 155..280 CDD:278560 43/126 (34%)
Cyclin_C 282..>392 CDD:281044 17/113 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447481
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.