DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycA and Ccnjl

DIOPT Version :9

Sequence 1:NP_524030.2 Gene:CycA / 39340 FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001032862.2 Gene:Ccnjl / 303059 RGDID:1561384 Length:387 Species:Rattus norvegicus


Alignment Length:293 Identity:69/293 - (23%)
Similarity:129/293 - (44%) Gaps:56/293 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 RQKDI------SHN----MRSILIDWLVEVSEEYKLDTETLYLSVFYLDRFLSQMAVVRSK-LQL 280
            |:|::      :|:    .|...:|.|..:|....|.....:|:::.||.|:.|..|..|| |..
  Rat    19 REKELKLPTFRAHSPLLKSRRFFVDILTLLSRHCHLCPSARHLAIYLLDHFMDQYNVTTSKQLYT 83

  Fly   281 VGTAAMYIAAKYE--EIYPPEVGE-----FVFLTDDSYTKAQVLRMEQVILKILSFDLCTPTAYV 338
            |..:.:.:|:|:|  |...|::.:     .:...:.|.||.::|..|.::|:..|:|||.||...
  Rat    84 VAVSCLLLASKFEDREDRVPKLDQINSTRILSSHNFSLTKKELLTTELLLLEAFSWDLCLPTPAH 148

  Fly   339 FINTYAVLCDMPEK------------------LKYMTLYISELSLMEGETYLQYLPSLMSSASVA 385
            |:: |.:|..:.:|                  ||....|..|::|.: ..:.::.||::::|.|.
  Rat   149 FLD-YYLLASISQKDHHCHTWPTTCLRKTKECLKEYAHYFLEVTLQD-HIFYKFQPSVVAAACVG 211

  Fly   386 LARHILGME-MWTPRLEEITTYKLEDLKTVVLHLCHTH----KTAKELNTQAM-----------R 434
            .:|..|.:. .||..|:.::.|.||.|.|.:..|...:    |.|..:.:||:           :
  Rat   212 ASRICLQLSPYWTRDLQRVSNYSLEHLSTCIEILLVAYDNVLKDAVAVKSQALAMVPSSSSAPTQ 276

  Fly   435 EKYNRDTYKKVAMMESVEMS--KDDFDQLCEAY 465
            ..:...||..::......::  :.....||.||
  Rat   277 VLFQPPTYPSLSQPPPTTLAQFQSPAQDLCLAY 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 31/122 (25%)
Cyclin_C 334..450 CDD:281044 32/149 (21%)
CcnjlNP_001032862.2 CYCLIN_CCNJ-like_rpt1 32..120 CDD:410231 20/87 (23%)
CYCLIN_CCNJ-like_rpt2 144..245 CDD:410232 25/102 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.