Sequence 1: | NP_524030.2 | Gene: | CycA / 39340 | FlyBaseID: | FBgn0000404 | Length: | 491 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571100.1 | Gene: | ccnd1 / 30222 | ZFINID: | ZDB-GENE-980526-176 | Length: | 291 | Species: | Danio rerio |
Alignment Length: | 206 | Identity: | 59/206 - (28%) |
---|---|---|---|
Similarity: | 105/206 - (50%) | Gaps: | 28/206 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 192 NDRQRFLEVVQYQMDILEYFRESEKKHRPKPLYMR-RQKDISHNMRSILIDWLVEVSEEYKLDTE 255
Fly 256 TLYLSVFYLDRFLSQMAVVRSKLQLVGTAAMYIAAKYEEIYPPEVGEFVFLTDDSYTKAQVLRME 320
Fly 321 QVILKILSFDLCTPTAYVFINTYAVLCDMPEKLK---------YMTLYISELSLMEGETYLQYLP 376
Fly 377 SLMSSASVALA 387 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CycA | NP_524030.2 | Cyclin_N | 206..332 | CDD:278560 | 44/126 (35%) |
Cyclin_C | 334..450 | CDD:281044 | 11/63 (17%) | ||
ccnd1 | NP_571100.1 | Cyclin_N | 27..153 | CDD:278560 | 44/125 (35%) |
Cyclin_C | 155..269 | CDD:281044 | 11/63 (17%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170579800 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |