DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycA and ccnd1

DIOPT Version :9

Sequence 1:NP_524030.2 Gene:CycA / 39340 FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_571100.1 Gene:ccnd1 / 30222 ZFINID:ZDB-GENE-980526-176 Length:291 Species:Danio rerio


Alignment Length:206 Identity:59/206 - (28%)
Similarity:105/206 - (50%) Gaps:28/206 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 NDRQRFLEVVQYQMDILEYFRESEKKHRPKPLYMR-RQKDISHNMRSILIDWLVEVSEEYKLDTE 255
            |||            :|:...::|:.:.|.|.|.: .||:|...||.|:..|::||.||.|.:.|
Zfish    24 NDR------------VLQTMLKAEENYLPSPNYFKCVQKEIVPKMRKIVATWMLEVCEEQKCEEE 76

  Fly   256 TLYLSVFYLDRFLSQMAVVRSKLQLVGTAAMYIAAKYEEIYPPEVGEFVFLTDDSYTKAQVLRME 320
            ...|::.|||||||.....:::|||:|...|::|:|.:|..|....:....||:|....::|:||
Zfish    77 VFPLAMNYLDRFLSVEPTKKTRLQLLGATCMFLASKMKETVPLTAEKLCIYTDNSVRPGELLQME 141

  Fly   321 QVILKILSFDLCTPTAYVFINTYAVLCDMPEKLK---------YMTLYISELSLMEGETYLQYLP 376
            .:.|..|.:||.:.|.:.||..:.....:.:..|         ::.|..::::      ::...|
Zfish   142 LLALNKLKWDLASVTPHDFIEHFLAKLPIHQSSKQILRKHAQTFVALCATDVN------FIASPP 200

  Fly   377 SLMSSASVALA 387
            |::::.|||.|
Zfish   201 SMIAAGSVAAA 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 44/126 (35%)
Cyclin_C 334..450 CDD:281044 11/63 (17%)
ccnd1NP_571100.1 Cyclin_N 27..153 CDD:278560 44/125 (35%)
Cyclin_C 155..269 CDD:281044 11/63 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579800
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.