DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycA and Ccnj

DIOPT Version :9

Sequence 1:NP_524030.2 Gene:CycA / 39340 FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001099839.1 Gene:Ccnj / 294053 RGDID:1306399 Length:379 Species:Rattus norvegicus


Alignment Length:268 Identity:74/268 - (27%)
Similarity:111/268 - (41%) Gaps:57/268 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 QYQMDILEYFRESEKKHRPKPLYMRRQKDISHNMRSILIDWLVEVSEEYKLDTETLYLSVFYLDR 266
            |...||.:..|..|.|   .|.|..:...:  |:|....|.:..||..:.|.....:|:|:.||.
  Rat    11 QLAADIHQALRYKELK---LPSYKGQSPQL--NLRRYFADLIAIVSNRFTLCPSARHLAVYLLDL 70

  Fly   267 FLSQMAVVRSKLQLVGTAAMYIAAKYEEIYPPEVGEFVFLTDDS-------------------YT 312
            |:.:......:|.||..:.:.:|:|:||            .:||                   .|
  Rat    71 FMDRYDSSIQQLHLVALSCLLLASKFEE------------KEDSVPKLEQLNSLGCMTNMNLVLT 123

  Fly   313 KAQVLRMEQVILKILSFDLCTPTAYVFINTY--------------AVLCDMPEKLKYMTLYIS-- 361
            |..:|.||.::|:...::||.|||..||..|              .::|....|| ||..|..  
  Rat   124 KQNLLHMELLLLETFQWNLCLPTAAHFIEYYLSEAVHETDLHDGWPMVCLEKTKL-YMAKYADYF 187

  Fly   362 -ELSLMEGETYLQYLPSLMSSASVALARHILGME-MWTPRLEEITTYKLEDLKTVVLHLCHTH-K 423
             |:||.: ..:|.|.|||:::|.||.:|.||.:. .|..||..:|.|..:.|...:..|...| .
  Rat   188 LEVSLQD-YAFLNYAPSLVAAACVASSRIILRLSPTWPTRLHRLTAYSWDFLVQCIERLLLAHDN 251

  Fly   424 TAKELNTQ 431
            ..||.|.|
  Rat   252 DVKEANKQ 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 33/144 (23%)
Cyclin_C 334..450 CDD:281044 38/117 (32%)
CcnjNP_001099839.1 CYCLIN 15..>109 CDD:294043 27/110 (25%)
Cyclin_C 145..274 CDD:281044 38/117 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339990
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.