DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycA and Ccng2

DIOPT Version :9

Sequence 1:NP_524030.2 Gene:CycA / 39340 FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001099195.1 Gene:Ccng2 / 29157 RGDID:1305002 Length:344 Species:Rattus norvegicus


Alignment Length:291 Identity:71/291 - (24%)
Similarity:127/291 - (43%) Gaps:34/291 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 ILEYFRESEKKHRPKPLYMRRQKDISHN-------MRSILIDWLVEVSEEYKLDTETLYLSVFYL 264
            :|.::.|.|::::|:...:...:....|       :|:..::.|..::..:...|||..|:|..|
  Rat    20 LLNFYLEQEQRYQPREKGLTLMEATPENDNTLCSRLRNAKVEDLRSLTNFFGSGTETFVLAVNIL 84

  Fly   265 DRFLSQMAVVRSKLQLVGTAAMYIAAKY--EEIYPPEVGEFVFLTDDSYTKAQVLRMEQVILKIL 327
            ||||:.|.|....|..:|.....:||:.  ||...|...:.:.::....|.:.:.|||::|.:.|
  Rat    85 DRFLALMKVKPKHLSCIGVCCFLLAARLAEEECDIPPTHDVIRISQCKCTASDIKRMEKIISEKL 149

  Fly   328 SFDLCTPTAYVFINTY--AVLCDMPEKLKYMTLYISELSLMEGETYLQYLPSLMSSASVALARHI 390
            .::|...||..|::.|  .|.|..||:.:.::|...|..|......|.:..:..|    .||..:
  Rat   150 HYELEATTALNFLHLYHAIVFCHSPERKEVLSLDKLEAQLKACNCRLVFSKAKPS----VLALCL 210

  Fly   391 LGMEMWTPRLEEITTYKLEDLKTVVLHLCHTHKTAKELNTQAMREKYNRDTYKK-VAMMESVEMS 454
            |.:|:.|.:..|:    ||.|..|..||       |..:|:..   |.|:...| :|...|....
  Rat   211 LNLEIETIKSVEL----LEILLLVKKHL-------KISDTEFF---YWRELVSKCLAEYSSPHCC 261

  Fly   455 KDDFDQLCEAYNCKQKEDEHQQ----PDINT 481
            |.|..:|....:.:..:..|..    |::.|
  Rat   262 KPDLKKLVWIVSRRTAQSLHNSYYSVPELPT 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 32/133 (24%)
Cyclin_C 334..450 CDD:281044 31/118 (26%)
Ccng2NP_001099195.1 CYCLIN_CCNG2 55..150 CDD:410287 26/94 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339987
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.