DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycA and ccng2

DIOPT Version :9

Sequence 1:NP_524030.2 Gene:CycA / 39340 FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_998337.1 Gene:ccng2 / 266794 ZFINID:ZDB-GENE-021016-1 Length:330 Species:Danio rerio


Alignment Length:302 Identity:60/302 - (19%)
Similarity:110/302 - (36%) Gaps:72/302 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 EKKHRPKPLYMR-------RQKDISHNMRSILIDWLVEVSEEYKLDTETLYLSVFYLDRFLSQMA 272
            |.::.||...:|       ....:|...|...::.|..::..:...|:|..|:|..|||||:.|.
Zfish    17 EVQYLPKETGLRLIESTQENSNGVSAKCRDARVEDLWSLTNFFGYSTQTFVLAVNLLDRFLAMMK 81

  Fly   273 VVRSKLQLVGTAAMYIAAKYEEIYPPEVG--------EFVFLTDDSYTKAQVLRMEQVILKILSF 329
            |....|..:....::||.:..|      |        |.:.::...:|.:.:.|||::|.:.|:|
Zfish    82 VQPKYLACISIGCLHIAVRVTE------GECNVSSSHELIRISQCKFTVSDLSRMEKIISEKLNF 140

  Fly   330 DLCTPTAYVFINTYAVLCDMPEKLKYMTLYISELSLMEGETYLQYLPSLMSSASVALAR------ 388
            .....||..|::.|..:.               ||.......:..|..|.:.....|.|      
Zfish   141 QFKAVTALTFLHLYHAIA---------------LSHTSNRKDVLNLDKLEAQLKACLCRIVFSKA 190

  Fly   389 --HILGMEMWTPRLEEITTYKLEDLKTVVLHLCHTH-KTAKE-------LNTQAMREKYNRDTYK 443
              .:|.:.:....:|.:.:..|.:    :.|...|| |.:|.       |..|.:|:        
Zfish   191 KPSVLALSLLMLEIEALQSADLLE----IAHRIQTHLKISKADLGRWRGLVGQCIRD-------- 243

  Fly   444 KVAMMESVEMSKDDFDQLCEAYNCKQKEDEHQQ----PDINT 481
                ..|.|.:|.|..:|....:.:..::.|..    |::.|
Zfish   244 ----YSSPECAKPDHKKLVWIVSRRTAQNLHSSYCSIPELPT 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 31/131 (24%)
Cyclin_C 334..450 CDD:281044 21/131 (16%)
ccng2NP_998337.1 CYCLIN <59..140 CDD:294043 23/86 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579795
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.