DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycA and Ccno

DIOPT Version :9

Sequence 1:NP_524030.2 Gene:CycA / 39340 FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001074531.1 Gene:Ccno / 218630 MGIID:2145534 Length:352 Species:Mus musculus


Alignment Length:292 Identity:83/292 - (28%)
Similarity:136/292 - (46%) Gaps:41/292 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 DLDSTPMSVTD-VQSPMSVDRSILGVIQSSDISVGTETGVSPTGRVKELPPRNDRQRFLEVVQYQ 204
            ||..:|.|.:| ..||        .|..:.|.|    :.::|...:..|    |.|.|.|   |.
Mouse    59 DLFESPSSSSDGADSP--------AVSAARDCS----SLLNPAQPLTAL----DLQTFRE---YG 104

  Fly   205 MDILEYFRESEKKHRPKPLYMRRQKDISHNMRSILIDWLVEVSEEYKLDTETLYLSVFYLDRFLS 269
            ....::.:..|....|:. .:.||..::...|..|:.||::|..::.|..|:|.|:|..|||||.
Mouse   105 QSCYDFRKAQENLFHPRE-SLARQPQVTAESRCKLLSWLLQVHRQFGLSFESLCLTVNTLDRFLL 168

  Fly   270 QMAVVRSKLQLVGTAAMYIAAKYEEIYPPEVGEFVFLTDDSYTKAQVLRMEQVILKILSFDLCTP 334
            ...|.....||:|...:.||.|..|::||.:.:.:.|...::::.|:..:|.::|..|.|.|..|
Mouse   169 TTPVAADCFQLLGVTCLLIACKQVEVHPPRLKQLLALCGGAFSRQQLCNLECIVLHKLHFSLGAP 233

  Fly   335 TAYVFINTY------AVLCDMPEKLKYMTLY--ISELSLMEGETYLQYLPSLMSSASVALA---- 387
            |...|:..:      |...::.|.|:..||.  ::||||.: ..:..|.||||:...:|||    
Mouse   234 TINFFLEHFTQWRMEAGQAEVTEALEAQTLARGVAELSLTD-YAFTTYTPSLMAICCLALADGLL 297

  Fly   388 RHILGMEMWTPRLEEITTYKLED----LKTVV 415
            :|...|::   ||.|.....|:|    |:|:|
Mouse   298 QHQHEMDL---RLGEHPEATLQDCLGKLQTLV 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 35/125 (28%)
Cyclin_C 334..450 CDD:281044 30/98 (31%)
CcnoNP_001074531.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40
Cyclin_N 108..231 CDD:278560 35/123 (28%)
Cyclin_C 233..>301 CDD:281044 21/68 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.