DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycA and T24A6.1

DIOPT Version :9

Sequence 1:NP_524030.2 Gene:CycA / 39340 FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001309661.1 Gene:T24A6.1 / 188821 WormBaseID:WBGene00020744 Length:91 Species:Caenorhabditis elegans


Alignment Length:101 Identity:24/101 - (23%)
Similarity:47/101 - (46%) Gaps:14/101 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 KLQLVGTAAMYIAAKYEEIYPPEVGEFVFLTDDSYTKAQVLRMEQVILKILSFDLCTPTAYVFIN 341
            :.:|||..:|.| .|..|..|           ::.|...:|.||:.::....|.:..||.....:
 Worm     2 RFKLVGMTSMMI-KKIRENLP-----------NNPTVPDILLMERFLIGKFEFVVAKPTPSWLGS 54

  Fly   342 TYAVLCDMPEKLKYMTLYISELSLMEGETYLQYLPS 377
            .:|...::.:|:: ..:.:.|||.::.. :|:|.||
 Worm    55 CFAKRINLTKKMR-NDVKLLELSPIDAH-FLRYRPS 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 13/54 (24%)
Cyclin_C 334..450 CDD:281044 11/44 (25%)
T24A6.1NP_001309661.1 COG5024 <2..88 CDD:227357 22/99 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.