DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycA and cya-2

DIOPT Version :9

Sequence 1:NP_524030.2 Gene:CycA / 39340 FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_494154.1 Gene:cya-2 / 186646 WormBaseID:WBGene00000864 Length:123 Species:Caenorhabditis elegans


Alignment Length:103 Identity:36/103 - (34%)
Similarity:55/103 - (53%) Gaps:7/103 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 MRSILIDWLVEVSEEYKLDTETLYLSVFYLDRFLSQMAVVRSKLQLVGTAAMYIAAKYEEIYPPE 299
            ||:|||||..:...||....|.::|:...:||.|....:.:.:.||||..:|.||.|||||:||.
 Worm     1 MRTILIDWFSDAVREYISRKEAVHLAASLVDRALPMFNIDKMRFQLVGITSMRIAVKYEEIFPPI 65

  Fly   300 VGEFVFLTDDS--YTKAQVLR--MEQVILKILSFDLCT 333
            :.......|.:  |.|.::.|  ...::.:|:   |||
 Worm    66 LSNTRHSFDGAILYWKVRLHRRNAHTILDRIM---LCT 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 33/100 (33%)
Cyclin_C 334..450 CDD:281044 36/103 (35%)
cya-2NP_494154.1 Cyclin_N <1..>68 CDD:365896 28/66 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.